SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG11921_3prime_partial:A_TrvaMG_comp26229_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0001764 P neuron migration
GO:0002009 P morphogenesis of an epithelium
GO:0003382 P epithelial cell morphogenesis
GO:0003402 P planar cell polarity pathway involved in axis elongation
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004715 F non-membrane spanning protein tyrosine kinase activity
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005911 C cell-cell junction
GO:0005912 C adherens junction
GO:0005927 C muscle tendon junction
GO:0005938 C cell cortex
GO:0006468 P protein phosphorylation
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007268 P chemical synaptic transmission
GO:0007303 P cytoplasmic transport, nurse cell to oocyte
GO:0007370 P ventral furrow formation
GO:0007391 P dorsal closure
GO:0007409 P axonogenesis
GO:0007411 P axon guidance
GO:0007417 P central nervous system development
GO:0007419 P ventral cord development
GO:0007611 P learning or memory
GO:0008045 P motor neuron axon guidance
GO:0008064 P regulation of actin polymerization or depolymerization
GO:0008360 P regulation of cell shape
GO:0010592 P positive regulation of lamellipodium assembly
GO:0010906 P regulation of glucose metabolic process
GO:0010977 P negative regulation of neuron projection development
GO:0016199 P axon midline choice point recognition
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0019897 C extrinsic component of plasma membrane
GO:0021785 P branchiomotor neuron axon guidance
GO:0030424 C axon
GO:0031234 C extrinsic component of cytoplasmic side of plasma membrane
GO:0031647 P regulation of protein stability
GO:0032880 P regulation of protein localization
GO:0038083 P peptidyl-tyrosine autophosphorylation
GO:0042127 P regulation of cell population proliferation
GO:0045087 P innate immune response
GO:0045179 C apical cortex
GO:0045886 P negative regulation of synaptic assembly at neuromuscular junction
GO:0046827 P positive regulation of protein export from nucleus
GO:0048749 P compound eye development
GO:0048813 P dendrite morphogenesis
GO:0070938 C contractile ring
GO:0072499 P photoreceptor cell axon guidance
RNA-seq EntryA_TrvaMG_comp26229_c0_seq1
Sequence
(Amino Acid)
MGAQQAKERGTASGASMRSARSKPRLPKDPRMLGSNIFTEHSEALLQSRPLPHIPDLPDE
AAAAPSAAAPLPLDAANRWTSKENLLAHHEEDDPQLFVALYDFQAGGENQLTLKKGEQVR
IMSYNKSGEWCEAHTLTGAVGWVPSNYVTPVNSLEKHSWYHGPISRNAAEYLLSSGINGS
FLVRESESSPGQRSISLRYEGRVYHYRINEDADGKVYVTSESKFGTLAELVHHHSVAGDG
LITQLLYPAPKRSKPTVFPLAPPDHWEIDRTDIVMKDKLGGGQYGDVYEAAWKRGNITVA
VKTLKDDTMALKDFLEEASIMKEMRHPNLVQLLGVCTREPPFYIITEFMSRGNLLEYLRA
GARDCVPGAVVLMYMATQIASGMSYLESRSFIHRDLAARNCLVGENHLVKVADFGLARLM
RDDTYTAHAGAKFPIKWTAPEGLAYNTFSTKSDVWAFGILLWEIATYGMSPYPGVDLADV
YHMLEKGYRMECPPGCPAPVYELMRGCWQWSPSDRPSFREIHHALEHMFQDNSITDEVEK
QLQEAGVSTPHLSLKKSSDPRTVQMRRPTNRRGKQAPTPPKRTSLLSSCSSFRESQYASE
EPALDDAPASLNGGAGRAGAGAGAGAASSEGSLAEGTPDTDESAGTEHRHRAKRRHHHHH
NEQPAHKQGVQVAALEVQNVKRAINRYGTLPKGARIGAFLESLRQSGGGNNAETARAVAG
GGAGVGASG
(242 a.a.)

- SilkBase 1999-2023 -