SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG11868_complete:A_TrvaMG_comp26209_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004691 F cAMP-dependent protein kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005952 C cAMP-dependent protein kinase complex
GO:0006468 P protein phosphorylation
GO:0007228 P positive regulation of hh target transcription factor activity
GO:0007314 P oocyte anterior/posterior axis specification
GO:0007317 P regulation of pole plasm oskar mRNA localization
GO:0007448 P anterior/posterior pattern specification, imaginal disc
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007480 P imaginal disc-derived leg morphogenesis
GO:0007611 P learning or memory
GO:0007612 P learning
GO:0007613 P memory
GO:0007615 P anesthesia-resistant memory
GO:0007622 P rhythmic behavior
GO:0008103 P oocyte microtubule cytoskeleton polarization
GO:0008355 P olfactory learning
GO:0008359 P regulation of bicoid mRNA localization
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0019933 P cAMP-mediated signaling
GO:0030425 C dendrite
GO:0040040 P thermosensory behavior
GO:0042981 P regulation of apoptotic process
GO:0044297 C cell body
GO:0045187 P regulation of circadian sleep/wake cycle, sleep
GO:0045475 P locomotor rhythm
GO:0045879 P negative regulation of smoothened signaling pathway
GO:0048149 P behavioral response to ethanol
GO:0048477 P oogenesis
GO:0048749 P compound eye development
GO:0050804 P modulation of chemical synaptic transmission
RNA-seq EntryA_TrvaMG_comp26209_c0_seq2
Sequence
(Amino Acid)
MGNNAATANKKVDAAESVKEFLDQAKEDFEEKWKKNPTNTAGLNDFERIKTLGTGSFGRV
MIVQHKPTKEYYAMKILDKQKVVKLKQVEHTLNEKRILQAINFPFLVSLKFHFKDNSNLY
MVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQ
GYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPP
FFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKGHKWF
ATTDWIAVFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAREFAEF
*(117 a.a.)

- SilkBase 1999-2023 -