SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG11603_5prime_partial:A_TrvaMG_comp26142_c0_seq3
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0003081 P regulation of systemic arterial blood pressure by renin-angiotensin
GO:0004177 F aminopeptidase activity
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0006508 P proteolysis
GO:0006725 P cellular aromatic compound metabolic process
GO:0008217 P regulation of blood pressure
GO:0008233 F peptidase activity
GO:0008237 F metallopeptidase activity
GO:0008270 F zinc ion binding
GO:0008283 P cell population proliferation
GO:0012506 C vesicle membrane
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016477 P cell migration
GO:0016787 F hydrolase activity
GO:0031983 C vesicle lumen
GO:0042277 F peptide binding
GO:0043171 P peptide catabolic process
GO:0046872 F metal ion binding
GO:0070006 F metalloaminopeptidase activity
RNA-seq EntryA_TrvaMG_comp26142_c0_seq3
Sequence
(Amino Acid)
PAPSGLSEISDNPEGAGAVWGHVRAHWTQLVHRFTLNSRYLGNLITSITNSFNTKQNLIE
MEEFFTLYPDAGAGETARKRALETVKNNIKWAQKHEQSVATWLKQRTS
*(35 a.a.)

- SilkBase 1999-2023 -