SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG11397_complete:A_TrvaMG_comp26110_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000432 P positive regulation of transcription from RNA polymerase II promoter by glucose
GO:0001666 P response to hypoxia
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005667 C transcription regulator complex
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0009411 P response to UV
GO:0019086 P late viral transcription
GO:0019899 F enzyme binding
GO:0019901 F protein kinase binding
GO:0032869 P cellular response to insulin stimulus
GO:0042803 F protein homodimerization activity
GO:0042826 F histone deacetylase binding
GO:0043425 F bHLH transcription factor binding
GO:0043565 F sequence-specific DNA binding
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046982 F protein heterodimerization activity
GO:0046983 F protein dimerization activity
GO:0055088 P lipid homeostasis
RNA-seq EntryA_TrvaMG_comp26110_c0_seq1
Sequence
(Amino Acid)
MAGEEAVTNPSPSPPHTDYNDTQFYVISNPVEVFGPSAASKKPIRRDPMQTKPVSAKKRD
DKRRATHNEVERRRRDKINSWITKLAALVPNSGMPDSASKGGILAKACDHITDLTEKQKR
LENVELDNKKLVFEVLRLNQELAELRKENTSMRNQLADNCVVIPKKSKEPKS
*(56 a.a.)

- SilkBase 1999-2023 -