SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG11178_complete:A_TrvaMG_comp26032_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000149 F SNARE binding
GO:0005484 F SNAP receptor activity
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005768 C endosome
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005802 C trans-Golgi network
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006887 P exocytosis
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006897 P endocytosis
GO:0006906 P vesicle fusion
GO:0006911 P phagocytosis, engulfment
GO:0008333 P endosome to lysosome transport
GO:0009986 C cell surface
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016192 P vesicle-mediated transport
GO:0017156 P calcium-ion regulated exocytosis
GO:0030027 C lamellipodium
GO:0030054 C cell junction
GO:0030133 C transport vesicle
GO:0030141 C secretory granule
GO:0030658 C transport vesicle membrane
GO:0030667 C secretory granule membrane
GO:0030670 C phagocytic vesicle membrane
GO:0031091 C platelet alpha granule
GO:0031143 C pseudopodium
GO:0031201 C SNARE complex
GO:0031410 C cytoplasmic vesicle
GO:0031902 C late endosome membrane
GO:0035493 P SNARE complex assembly
GO:0035577 C azurophil granule membrane
GO:0043001 P Golgi to plasma membrane protein transport
GO:0043005 C neuron projection
GO:0043231 C intracellular membrane-bounded organelle
GO:0043308 P eosinophil degranulation
GO:0043312 P neutrophil degranulation
GO:0043320 P natural killer cell degranulation
GO:0045177 C apical part of cell
GO:0045202 C synapse
GO:0045335 C phagocytic vesicle
GO:0048471 C perinuclear region of cytoplasm
GO:0050775 P positive regulation of dendrite morphogenesis
GO:0070062 C extracellular exosome
GO:1900483 P regulation of protein targeting to vacuolar membrane
GO:1903595 P positive regulation of histamine secretion by mast cell
RNA-seq EntryA_TrvaMG_comp26032_c0_seq1
Sequence
(Amino Acid)
MPILFSAVARGTVVLAKYATCQGNFTEVAEQILSKIPPHDDKLTYSHGNYLFHYIAENKL
VYFCITDDKFQRSRAFLFLNEIKRRFTTAFGDTAQTAIPYAMNGEFARVLATEMKHYSDS
KDLDTISRVHGELDELKNIMVKNIDNMAMRGEKLELLVNKADNLATSSVSYRNTSRTLQR
SLFWKNIKMYVILISIAALAVYLIGAMACGGLAWKSCVG
*(72 a.a.)

- SilkBase 1999-2023 -