SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG1112_complete:A_TrvaMG_comp12991_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_transcription_elongation_factor_SPT4_[Plutella_xylostella]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0005634 C nucleus
GO:0005703 C polytene chromosome puff
GO:0005705 C polytene chromosome interband
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006368 P transcription elongation from RNA polymerase II promoter
GO:0008023 C transcription elongation factor complex
GO:0008270 F zinc ion binding
GO:0032785 P negative regulation of DNA-templated transcription, elongation
GO:0032786 P positive regulation of DNA-templated transcription, elongation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0046982 F protein heterodimerization activity
RNA-seq EntryA_TrvaMG_comp12991_c0_seq1
Sequence
(Amino Acid)
MSIETVPKDLRGLRACLVCSLIKTTEQFEYDGCDNCDEFLRMKKNKDNVYDCTSNNFDGM
IAVMNPEDSWVCKWQRISRFCKGVYAISVSGRLPAGVIRDMKSRGIAYRPRDTSQR
*(38 a.a.)

- SilkBase 1999-2023 -