SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG110_internal:A_TrvaMG_comp11272_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		hemolymph_protein_14_[Bombyx_mori]
Ontology
GO:0004872 F signaling receptor activity
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005615 C extracellular space
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005886 C plasma membrane
GO:0005903 C brush border
GO:0005905 C clathrin-coated pit
GO:0006766 P vitamin metabolic process
GO:0006897 P endocytosis
GO:0006898 P receptor-mediated endocytosis
GO:0007568 P aging
GO:0010165 P response to X-ray
GO:0010951 P negative regulation of endopeptidase activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016197 P endosomal transport
GO:0016324 C apical plasma membrane
GO:0017124 F SH3 domain binding
GO:0020028 P endocytic hemoglobin import into cell
GO:0030165 F PDZ domain binding
GO:0030492 F hemoglobin binding
GO:0031100 P animal organ regeneration
GO:0031526 C brush border membrane
GO:0032403 F protein-containing complex binding
GO:0032526 P response to retinoic acid
GO:0033280 P response to vitamin D
GO:0042493 P response to xenobiotic stimulus
GO:0042562 F hormone binding
GO:0042953 P lipoprotein transport
GO:0042954 F obsolete lipoprotein transporter activity
GO:0043234 C protein-containing complex
GO:0045056 P transcytosis
GO:0045121 C membrane raft
GO:0046872 F metal ion binding
GO:0046879 P hormone secretion
GO:0050750 F low-density lipoprotein particle receptor binding
RNA-seq EntryA_TrvaMG_comp11272_c0_seq1
Sequence
(Amino Acid)
KCQDGTIIPSTSYCDGAPDCPDGSDETVWACAGIQCASYLFQCAYGACVDAGSDCNGIKE
CADGSDESDDLCDKRLPSKPTQKPTSGACVLPQYPAHGSYVVLNTPNAAPGQAFDSIQVN
VTCKPGYGVVGRNDVFCLSGWWSDKLPQCIRLCKLNAHPSVEYKCLLTDGIDGTRPCNTY
EPTGTIVQPK
(62 a.a.)

- SilkBase 1999-2023 -