SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG10930_5prime_partial:A_TrvaMG_comp25991_c0_seq3
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000123 C histone acetyltransferase complex
GO:0004402 F histone acetyltransferase activity
GO:0005634 C nucleus
GO:0005705 C polytene chromosome interband
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006974 P cellular response to DNA damage stimulus
GO:0007399 P nervous system development
GO:0010468 P regulation of gene expression
GO:0016568 P chromatin organization
GO:0016573 P histone acetylation
GO:0016740 F transferase activity
GO:0016746 F acyltransferase activity
GO:0016747 F acyltransferase activity, transferring groups other than amino-acyl groups
GO:0035267 C NuA4 histone acetyltransferase complex
GO:0043486 P histone exchange
GO:0043524 P negative regulation of neuron apoptotic process
GO:0043967 P histone H4 acetylation
GO:0048167 P regulation of synaptic plasticity
GO:2000331 P regulation of terminal button organization
RNA-seq EntryA_TrvaMG_comp25991_c0_seq3
Sequence
(Amino Acid)
QTECCFYLHKNNFKQKMNENDDDLTTFCDSTSSLVEGCRLPVRMQGGDDWPLAEIISIKE
VQGQRGYYVHYVDFNKRLDEWVGESWLDTRKVQFPRRDGSTTGGTTTPKKTHIGSGGGVM
PSFINDTVCNENQKSSIARPITNHLIQPKHEKAHYSNVLNGSAQKKCTCCN
*(56 a.a.)

- SilkBase 1999-2023 -