SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG10895_complete:A_TrvaMG_comp25979_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000209 P protein polyubiquitination
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0007249 P I-kappaB kinase/NF-kappaB signaling
GO:0008270 F zinc ion binding
GO:0009898 C cytoplasmic side of plasma membrane
GO:0010803 P regulation of tumor necrosis factor-mediated signaling pathway
GO:0016874 F ligase activity
GO:0023035 P CD40 signaling pathway
GO:0031625 F ubiquitin protein ligase binding
GO:0035631 C CD40 receptor complex
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043130 F ubiquitin binding
GO:0046872 F metal ion binding
GO:0050852 P T cell receptor signaling pathway
GO:0051092 P positive regulation of NF-kappaB transcription factor activity
GO:0071797 C LUBAC complex
GO:0097039 P protein linear polyubiquitination
GO:1903955 P positive regulation of protein targeting to mitochondrion
RNA-seq EntryA_TrvaMG_comp25979_c0_seq2
Sequence
(Amino Acid)
MHFTCTQCKYEFCYGCGKPFTMGARCGLSDYCAKLGLHAHHPRNCLFYLRDKEPHELQTL
LQMNNVSYETEAAPGSTGRCPTQLQRETPTGLVDGVCGSEAPANYAGLCKPHYVEYLAGL
ARRLDPIPIMDVPELVAELRRRALPLPERGPWDTDPIYAGMCAEIVKEKIPLD
*(57 a.a.)

- SilkBase 1999-2023 -