SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG10844_internal:A_TrvaMG_comp25961_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000165 P MAPK cascade
GO:0000166 F nucleotide binding
GO:0000186 P obsolete activation of MAPKK activity
GO:0001890 P placenta development
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004702 F obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0004709 F MAP kinase kinase kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0006468 P protein phosphorylation
GO:0010225 P response to UV-C
GO:0010468 P regulation of gene expression
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0019100 P male germ-line sex determination
GO:0032212 P positive regulation of telomere maintenance via telomerase
GO:0035556 P intracellular signal transduction
GO:0043507 P positive regulation of JUN kinase activity
GO:0046872 F metal ion binding
GO:0048263 P determination of dorsal identity
GO:0048471 C perinuclear region of cytoplasm
GO:0051973 P positive regulation of telomerase activity
GO:0060718 P chorionic trophoblast cell differentiation
GO:1900745 P positive regulation of p38MAPK cascade
GO:1904355 P positive regulation of telomere capping
RNA-seq EntryA_TrvaMG_comp25961_c0_seq1
Sequence
(Amino Acid)
ETTAMRLPSYRGHFLLLSSICLEAVHDYLAFRLEVTPDRPSCLTVKQLIHELKEGLDIAS
EMRLDFVRNVRAALAGRSAGAAADQLRVMINIYDDTMRDVLKQYLSYLTLMSETEHMSRA
ALQVEWEFTARLARRIHCASQLAPLTFSEIACNQLNRLHKTFEDNFQHLIQTARSDIETN
RHAVYAVCRLAQSMYTCEREHTLQAAQWARALSARLQRAPPPAYTEQRGQIFECLMKIRD
FILKNVEYILQESKTPPEDLNKEMHESVVGRVRELLLQIFKLGFEFHKELYKF
(96 a.a.)

- SilkBase 1999-2023 -