SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG10746_complete:A_TrvaMG_comp25921_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0000228 C nuclear chromosome
GO:0000785 C chromatin
GO:0000805 C X chromosome
GO:0003676 F nucleic acid binding
GO:0003682 F chromatin binding
GO:0003723 F RNA binding
GO:0003724 F RNA helicase activity
GO:0003725 F double-stranded RNA binding
GO:0004004 F RNA helicase activity
GO:0004386 F helicase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005665 C RNA polymerase II, core complex
GO:0005694 C chromosome
GO:0005700 C polytene chromosome
GO:0005737 C cytoplasm
GO:0006396 P RNA processing
GO:0007549 P dosage compensation
GO:0008026 F helicase activity
GO:0008340 P determination of adult lifespan
GO:0009047 P dosage compensation by hyperactivation of X chromosome
GO:0016456 C X chromosome located dosage compensation complex, transcription activating
GO:0016457 P dosage compensation complex assembly involved in dosage compensation by hyperactivation of X chromosome
GO:0016787 F hydrolase activity
GO:0031453 P positive regulation of heterochromatin assembly
GO:0044822 F RNA binding
GO:0045433 P male courtship behavior, veined wing generated song production
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048675 P axon extension
GO:0072487 C MSL complex
RNA-seq EntryA_TrvaMG_comp25921_c0_seq1
Sequence
(Amino Acid)
MDNKSFLYSWCSKKGITPLFDIRATGPRHRQRFLCEVRVEGFSYLGAGNSTTKKDAQMNA
AKDFVSYLVRAGQVAAADVPEDVKGKITEVALNEQSDNGGSLQQKQVFQEGQGPEVIGPA
YQAYGGDKDKKFTYIDRMQQQKNVEEAEDLDVNASLHGNWTMENAKSKLHQFLQINKINA
DYVYKAVGPDHTRSFACELSIYVSQLGRNVTSRETASNKQTASKSCALSIVRQLYHLGVI
DAYSGTLKRDRSAEGIMKPYPVAIDPELELQIEETLHELGIQPVSVDDHSKSVNQEGGVT
LLQKDRAKQ
*(102 a.a.)

- SilkBase 1999-2023 -