SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG10591_complete:A_TrvaMG_comp25892_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_bone_morphogenetic_protein_receptor_type-1B_isoform_X3_[Papilio_machaon]
Ontology
GO:0000166 F nucleotide binding
GO:0001501 P skeletal system development
GO:0001502 P cartilage condensation
GO:0001550 P ovarian cumulus expansion
GO:0001654 P eye development
GO:0001948 F protein binding
GO:0002062 P chondrocyte differentiation
GO:0002063 P chondrocyte development
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004675 F transmembrane receptor protein serine/threonine kinase activity
GO:0004702 F obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0005024 F transforming growth factor beta-activated receptor activity
GO:0005025 F transforming growth factor beta receptor activity, type I
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005886 C plasma membrane
GO:0006468 P protein phosphorylation
GO:0006703 P estrogen biosynthetic process
GO:0006954 P inflammatory response
GO:0007178 P transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0009953 P dorsal/ventral pattern formation
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0023014 P signal transduction
GO:0030154 P cell differentiation
GO:0030166 P proteoglycan biosynthetic process
GO:0030425 C dendrite
GO:0030501 P positive regulation of bone mineralization
GO:0030509 P BMP signaling pathway
GO:0031290 P retinal ganglion cell axon guidance
GO:0032332 P positive regulation of chondrocyte differentiation
GO:0035108 P limb morphogenesis
GO:0042698 P ovulation cycle
GO:0043010 P camera-type eye development
GO:0043025 C neuronal cell body
GO:0045597 P positive regulation of cell differentiation
GO:0045669 P positive regulation of osteoblast differentiation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046332 F SMAD binding
GO:0046872 F metal ion binding
GO:0051216 P cartilage development
GO:0060041 P retina development in camera-type eye
GO:0060350 P endochondral bone morphogenesis
GO:0061036 P positive regulation of cartilage development
GO:0071363 P cellular response to growth factor stimulus
GO:0071773 P cellular response to BMP stimulus
GO:1902043 P positive regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:1902731 P negative regulation of chondrocyte proliferation
RNA-seq EntryA_TrvaMG_comp25892_c0_seq1
Sequence
(Amino Acid)
MGRGLRCECAGAGACPDGSANGTCVTQVGGYCFVTVEEVFDDYGNVVIDRTAGCLPGDEP
GLMQCKGAIVPHKHPKLIQCCNNEDLCNLRLHPQLSDPLPEDTDWGISRGGVHSPVMSSP
MLLVAIALCVAFIAFLAAFLLLYRRRKRGCKRPPSPPAPPICSEISSGSGSGLPLLVQRT
VAKQIQMVESIGKGRYGEVWLARWRGDKVAVKVFFTTEEASWFRETEIYQTVLMRHDNIL
GFIAADIKGTGSWTQMLLITDYHENGSLHDYLQTVVLDSNSLMTMTYSIVSGLAHLHMDI
YGTKGKPAIAHRDIKSKNILVKRNGQCAIADFGLAVRYIADRNEVDIAPNTRVGTRRYMA
PEVLDETLDVTDFEAFKMADMYSLGLVLWEVCRRCASGDKAQLVEPYALPYQDAVPPDPS
FEDMHAVVVRAGSRPALPARWRHCERLAALGALMAECWAATPRARLSALRVKKSLGKFRT
ETTLKLV
*(161 a.a.)

- SilkBase 1999-2023 -