SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG10590_complete:A_TrvaMG_comp25891_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_serine/threonine-protein_kinase_PAK_3_isoform_X1_[Bombyx_mori]
Ontology
GO:0000165 P MAPK cascade
GO:0000166 F nucleotide binding
GO:0000187 P obsolete activation of MAPK activity
GO:0000278 P mitotic cell cycle
GO:0003824 F catalytic activity
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004702 F obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0004708 F MAP kinase kinase activity
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0006468 P protein phosphorylation
GO:0007275 P multicellular organism development
GO:0007409 P axonogenesis
GO:0008152 P metabolic process
GO:0010763 P positive regulation of fibroblast migration
GO:0010975 P regulation of neuron projection development
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016358 P dendrite development
GO:0016740 F transferase activity
GO:0017048 F small GTPase binding
GO:0017124 F SH3 domain binding
GO:0030833 P regulation of actin filament polymerization
GO:0032956 P regulation of actin cytoskeleton organization
GO:0035556 P intracellular signal transduction
GO:0043525 P positive regulation of neuron apoptotic process
GO:0046872 F metal ion binding
GO:0051020 F GTPase binding
GO:0060996 P dendritic spine development
GO:0061003 P positive regulation of dendritic spine morphogenesis
GO:0071407 P cellular response to organic cyclic compound
GO:2000573 P positive regulation of DNA biosynthetic process
RNA-seq EntryA_TrvaMG_comp25891_c0_seq2
Sequence
(Amino Acid)
MEYLAGGSLTDVVTETCMDEGQIAAVCREVLQALHFLHTNHVIHRDIKSDNILLGLDGQV
KLTDFGFCAQISPEQNKRTTMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMAIEMIEGEPP
YLNENPLRALYLIATNGKPDIKDKDKLSTVFQDFLDQCLEVDVERRATALDLLKHPFLKM
ARPLASLTPLIMAAKEAAKGH
*(66 a.a.)

- SilkBase 1999-2023 -