| Name | O_TrvaMG10469_complete:A_TrvaMG_comp25857_c0_seq2 |
| Scaffold_id | |
NCBI non-redundant
(nr) | PREDICTED:_heterogeneous_nuclear_ribonucleoprotein_R_isoform_X3_[Amyelois_transitella] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0003676 |
F |
nucleic acid binding |
| GO:0003723 |
F |
RNA binding |
| GO:0003730 |
F |
mRNA 3'-UTR binding |
| GO:0005634 |
C |
nucleus |
| GO:0005654 |
C |
nucleoplasm |
| GO:0005681 |
C |
spliceosomal complex |
| GO:0005737 |
C |
cytoplasm |
| GO:0005783 |
C |
endoplasmic reticulum |
| GO:0006397 |
P |
mRNA processing |
| GO:0007623 |
P |
circadian rhythm |
| GO:0008380 |
P |
RNA splicing |
| GO:0016020 |
C |
membrane |
| GO:0030529 |
C |
ribonucleoprotein complex |
| GO:0043025 |
C |
neuronal cell body |
| GO:0043231 |
C |
intracellular membrane-bounded organelle |
| GO:0045727 |
P |
positive regulation of translation |
| GO:0048027 |
F |
mRNA 5'-UTR binding |
| GO:0070937 |
C |
CRD-mediated mRNA stability complex |
| GO:0071204 |
C |
histone pre-mRNA 3'end processing complex |
| GO:0090367 |
P |
negative regulation of mRNA modification |
| GO:1990635 |
C |
proximal dendrite |
|
| RNA-seq Entry | A_TrvaMG_comp25857_c0_seq2 |
Sequence
(Amino Acid) | MSKVKVLYVRNLTQDITEEALKEEFEHFGNVERVKKIKDYAFVHFDDRDAAVKAMQELDG
KDLGGSRLEVSLAKPPSDKKKKEEILRARERRMMQMIHGRSGFDWCGCSPPHAGRGRTPQ
QAPRPQHSRPDYGWVMWDGRSVGASRGRGWGPWWCSPRRSWPAHAQRHAWQPARQPKFTR
*(59 a.a.) |
