SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG10468_complete:A_TrvaMG_comp25857_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_heterogeneous_nuclear_ribonucleoprotein_R-like_[Plutella_xylostella]
Ontology
GO:0000166 F nucleotide binding
GO:0000398 P mRNA splicing, via spliceosome
GO:0001649 P osteoblast differentiation
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0003730 F mRNA 3'-UTR binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005681 C spliceosomal complex
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0006396 P RNA processing
GO:0006397 P mRNA processing
GO:0006417 P regulation of translation
GO:0007623 P circadian rhythm
GO:0008143 F poly(A) binding
GO:0008380 P RNA splicing
GO:0016020 C membrane
GO:0016032 P viral process
GO:0017148 P negative regulation of translation
GO:0030529 C ribonucleoprotein complex
GO:0043025 C neuronal cell body
GO:0043231 C intracellular membrane-bounded organelle
GO:0044822 F RNA binding
GO:0045727 P positive regulation of translation
GO:0048027 F mRNA 5'-UTR binding
GO:0070934 P CRD-mediated mRNA stabilization
GO:0070937 C CRD-mediated mRNA stability complex
GO:0071013 C catalytic step 2 spliceosome
GO:0071204 C histone pre-mRNA 3'end processing complex
GO:0071346 P cellular response to interferon-gamma
GO:0090367 P negative regulation of mRNA modification
GO:0097452 C GAIT complex
GO:1990635 C proximal dendrite
RNA-seq EntryA_TrvaMG_comp25857_c0_seq2
Sequence
(Amino Acid)
MAEGNGEIPYDEVAGKDSDVGRTADYHKLLEYGLDPKVAAKLDDIYKTGKLAHAELDERA
LDALKEFPSDGALSVLGQFLDSNLEHVSNKSAFLCGVMKTYRQKSRAGVPGAPALTPTVP
VKGPDEEKIKQILARTGYTLDVTTGQRKYGGPPPGWEGGTPGAGCEVFCGKIPKDMYEDE
LIPLFERCGTIWDLRLMMDPMTGANRGYAFVTFTTRDATQRAVHEVSHPTHVPTRTHTHP
QTHVHVHTRYLQLHWYKGK
*(85 a.a.)

- SilkBase 1999-2023 -