SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG10399_5prime_partial:A_TrvaMG_comp25837_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_SH2B_adapter_protein_1_[Bombyx_mori]
Ontology
GO:0001725 C stress fiber
GO:0001726 C ruffle
GO:0001922 P B-1 B cell homeostasis
GO:0004871 F obsolete signal transducer activity
GO:0005068 F transmembrane receptor protein tyrosine kinase adaptor activity
GO:0005070 F obsolete SH3/SH2 adaptor activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005884 C actin filament
GO:0005886 C plasma membrane
GO:0007165 P signal transduction
GO:0007399 P nervous system development
GO:0008269 F JAK pathway signal transduction adaptor activity
GO:0008286 P insulin receptor signaling pathway
GO:0009967 P positive regulation of signal transduction
GO:0016020 C membrane
GO:0019221 P cytokine-mediated signaling pathway
GO:0019222 P regulation of metabolic process
GO:0030036 P actin cytoskeleton organization
GO:0035556 P intracellular signal transduction
GO:0035591 F signaling adaptor activity
GO:0042593 P glucose homeostasis
GO:0042802 F identical protein binding
GO:0046325 P negative regulation of glucose import
GO:0046425 P regulation of receptor signaling pathway via JAK-STAT
GO:0046578 P regulation of Ras protein signal transduction
GO:0050776 P regulation of immune response
GO:0050851 P antigen receptor-mediated signaling pathway
GO:0050873 P brown fat cell differentiation
RNA-seq EntryA_TrvaMG_comp25837_c0_seq2
Sequence
(Amino Acid)
PDLSSSMNKHNKTKLAKIVVECRKEGLVNYLTPESLEQPSGPQKWEKCRLALVKTVGGYM
LEFYSPPKSQKPRSGVFCFLISEARETTALEMPDHENTFVLKTTTWNM
*(35 a.a.)

- SilkBase 1999-2023 -