SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG1034_complete:A_TrvaMG_comp12899_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		Programmed_cell_death_protein_5-like_protein_[Operophtera_brumata]
Ontology
GO:0003677 F DNA binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006915 P apoptotic process
GO:0008201 F heparin binding
GO:0008285 P negative regulation of cell population proliferation
GO:0010628 P positive regulation of gene expression
GO:0010698 F acetyltransferase activator activity
GO:0043065 P positive regulation of apoptotic process
GO:0043280 P positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0048487 F beta-tubulin binding
GO:0070062 C extracellular exosome
GO:0071560 P cellular response to transforming growth factor beta stimulus
GO:0090200 P positive regulation of release of cytochrome c from mitochondria
GO:1903638 P positive regulation of protein insertion into mitochondrial outer membrane
GO:1903645 P negative regulation of chaperone-mediated protein folding
RNA-seq EntryA_TrvaMG_comp12899_c0_seq1
Sequence
(Amino Acid)
MDDPELDQIRQQRLAQLQAQQGGTGDPNNAKAQQEKMQAMEQAKHTILSQALSQDARARL
NTIKLSKPEKAAMIENMICRMAQTGQIQCKISENDLIQILESFNQQMPKSRSTVKFDRRR
AALDSDDDDF
*(42 a.a.)

- SilkBase 1999-2023 -