SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG10225_internal:A_TrvaMG_comp25782_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_gamma-glutamyltranspeptidase_1_isoform_X2_[Bombyx_mori]
Ontology
GO:0003840 F obsolete gamma-glutamyltransferase activity
GO:0005615 C extracellular space
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006508 P proteolysis
GO:0006536 P glutamate metabolic process
GO:0006749 P glutathione metabolic process
GO:0006750 P glutathione biosynthetic process
GO:0006751 P glutathione catabolic process
GO:0007568 P aging
GO:0008233 F peptidase activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016740 F transferase activity
GO:0016746 F acyltransferase activity
GO:0016787 F hydrolase activity
GO:0031179 P peptide modification
GO:0031638 P zymogen activation
GO:0032355 P response to estradiol
GO:0032496 P response to lipopolysaccharide
GO:0034599 P cellular response to oxidative stress
GO:0034612 P response to tumor necrosis factor
GO:0036374 F glutathione hydrolase activity
RNA-seq EntryA_TrvaMG_comp25782_c0_seq1
Sequence
(Amino Acid)
DTMTSNDTATYGADEYNPSDSGTAHISIIGTNGDAVSVTSSINFYYGAGFSTLNTGIVMN
NVMDDFSSPGIINYFGVKPSAANFIAPGKRPLSSMSPSIIVDKNGDAKMVIGASGGTKIT
TGMAWVIISKLWFGETIKQAVDKPRIHHQLFPMNIAYEY
(52 a.a.)

- SilkBase 1999-2023 -