SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaMG10176_internal:A_TrvaMG_comp25759_c2_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_zinc_finger_protein_ush_isoform_X1_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001102 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0002805 P regulation of antimicrobial peptide biosynthetic process
GO:0003677 F DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007362 P terminal region determination
GO:0007390 P germ-band shortening
GO:0007391 P dorsal closure
GO:0007393 P dorsal closure, leading edge cell fate determination
GO:0007398 P ectoderm development
GO:0007507 P heart development
GO:0008134 F transcription factor binding
GO:0008258 P head involution
GO:0008293 P torso signaling pathway
GO:0009996 P negative regulation of cell fate specification
GO:0022416 P chaeta development
GO:0030097 P hemopoiesis
GO:0035167 P larval lymph gland hemopoiesis
GO:0042440 P pigment metabolic process
GO:0042690 P negative regulation of crystal cell differentiation
GO:0043433 P negative regulation of DNA-binding transcription factor activity
GO:0046665 P amnioserosa maintenance
GO:0046872 F metal ion binding
GO:0048542 P lymph gland development
GO:0048749 P compound eye development
RNA-seq EntryA_TrvaMG_comp25759_c2_seq1
Sequence
(Amino Acid)
CSTRQVVKQAIQAIKGGSATSGSAPPSPGATPPAQNQLALALPTNPILIVPYTLLRSAST
LPGTTLPDPDTPCFLLPNGTFQPLSHMLPNLNAGDKTPEVLKSANRPRESSRDGTTPLDL
SVRRTPESVVKDEHEKENRIRSATPEQIVCAPSLPGSPGTPSPSRRSSSPGGESSPKRRR
RNSRGPTLKPPSIPSPPAAPPIISPALAIRLASEMPVTTSPQVLV
(74 a.a.)

- SilkBase 1999-2023 -