SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG10118_3prime_partial:A_TrvaMG_comp25735_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
transcription_factor_AP-4_[Bombyx_mori]
Ontology
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677 F DNA binding
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003713 F transcription coactivator activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006461 P protein-containing complex assembly
GO:0006978 P DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator
GO:0008285 P negative regulation of cell population proliferation
GO:0010629 P negative regulation of gene expression
GO:0017053 C transcription repressor complex
GO:0042803 F protein homodimerization activity
GO:0042826 F histone deacetylase binding
GO:0043065 P positive regulation of apoptotic process
GO:0043392 P negative regulation of DNA binding
GO:0043565 F sequence-specific DNA binding
GO:0043922 P negative regulation by host of viral transcription
GO:0043923 P positive regulation by host of viral transcription
GO:0044212 F transcription cis-regulatory region binding
GO:0045736 P negative regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046982 F protein heterodimerization activity
GO:0046983 F protein dimerization activity
GO:0070888 F E-box binding
GO:0071157 P regulation of cell cycle
GO:0071549 P cellular response to dexamethasone stimulus
GO:2001269 P positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
RNA-seq EntryA_TrvaMG_comp25735_c0_seq1
Sequence
(Amino Acid)
MSLHGNDVCLLEVEDYNLYEEEASDHTFASDKHSAPGSKTMEAEKRIRREIANSNERRRM
QSINAGFQALRTLLPRHEGEKLSKAAILQQTAEYIYNLEQEKTRLLSQNCQLKRLLNQHE
GGEVPLKKRKGDILTHV
(44 a.a.)

- SilkBase 1999-2023 -