SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaMG10039_complete:A_TrvaMG_comp25703_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_integrin-linked_protein_kinase_[Amyelois_transitella]
Ontology
GO:0000166 F nucleotide binding
GO:0001558 P regulation of cell growth
GO:0001658 P branching involved in ureteric bud morphogenesis
GO:0001725 C stress fiber
GO:0001954 P positive regulation of cell-matrix adhesion
GO:0003151 P outflow tract morphogenesis
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004871 F obsolete signal transducer activity
GO:0005178 F integrin binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0005925 C focal adhesion
GO:0006468 P protein phosphorylation
GO:0006469 P negative regulation of protein kinase activity
GO:0007050 P regulation of cell cycle
GO:0007160 P cell-matrix adhesion
GO:0007229 P integrin-mediated signaling pathway
GO:0007569 P cell aging
GO:0008283 P cell population proliferation
GO:0008284 P positive regulation of cell population proliferation
GO:0010667 P negative regulation of cardiac muscle cell apoptotic process
GO:0010761 P fibroblast migration
GO:0014044 P Schwann cell development
GO:0014912 P negative regulation of smooth muscle cell migration
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0017124 F SH3 domain binding
GO:0018105 P peptidyl-serine phosphorylation
GO:0019901 F protein kinase binding
GO:0021675 P nerve development
GO:0022011 P myelination in peripheral nervous system
GO:0030017 C sarcomere
GO:0030027 C lamellipodium
GO:0030030 P cell projection organization
GO:0030054 C cell junction
GO:0030335 P positive regulation of cell migration
GO:0030424 C axon
GO:0030513 P positive regulation of BMP signaling pathway
GO:0031012 C extracellular matrix
GO:0032288 P myelin assembly
GO:0032956 P regulation of actin cytoskeleton organization
GO:0034329 P cell junction assembly
GO:0034446 P substrate adhesion-dependent cell spreading
GO:0042327 P positive regulation of phosphorylation
GO:0042995 C cell projection
GO:0043025 C neuronal cell body
GO:0043034 C costamere
GO:0043066 P negative regulation of apoptotic process
GO:0043195 C terminal bouton
GO:0043198 C dendritic shaft
GO:0043206 P supramolecular fiber organization
GO:0043234 C protein-containing complex
GO:0043406 P positive regulation of MAP kinase activity
GO:0043410 P positive regulation of MAPK cascade
GO:0043491 P protein kinase B signaling
GO:0043524 P negative regulation of neuron apoptotic process
GO:0045197 P establishment or maintenance of epithelial cell apical/basal polarity
GO:0045663 P positive regulation of myoblast differentiation
GO:0045669 P positive regulation of osteoblast differentiation
GO:0045773 P positive regulation of axon extension
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0048662 P negative regulation of smooth muscle cell proliferation
GO:0048812 P neuron projection morphogenesis
GO:0050772 P positive regulation of axonogenesis
GO:0050775 P positive regulation of dendrite morphogenesis
GO:0051291 P protein heterooligomerization
GO:0051897 P positive regulation of protein kinase B signaling
GO:0070527 P platelet aggregation
GO:0090263 P positive regulation of canonical Wnt signaling pathway
GO:2000178 P negative regulation of neural precursor cell proliferation
RNA-seq EntryA_TrvaMG_comp25703_c0_seq1
Sequence
(Amino Acid)
MEDIFQWCREGNALQIRVWLDDTEHDMNQGDDHGFSPLHWACKEGHLKIVEMFIKRGARI
NVTNMGDDTPLHLAAAHGHRPVVQLLLQNRVDVNFTNEHGNSPLHYACFWGYSAIAEDLL
LAGALVSIANKYGDTPLDKTRGQLVQRLHELATQQGQDLKKIQFKDQSWLGYKTRSRDAT
LSRHKGININELALHTQMAVTPSGETWRGRWQKNDIVAKILAIRECTPRIQRDFNEEFPK
LRIFSHPNILPVVGCCVSPPSLVVISQYMSWGSLHALLHGGAGGRVVVDAAAALRLAHDV
ARGMAYLHSLQPDSVLPAYHLNSKHIMIDEDMTARINMADAKFSFMERGRVYAPAWMAPE
ALLKPPAKRNWEAADMWSFAVLLWELATREIPFADLSPMECGMKIALEGLRVSIPPGVSP
HVSKLITICMNEDPGKRPSFEMILPILEKMKK
*(150 a.a.)

- SilkBase 1999-2023 -