SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG29025_complete:A_TrvaFAMAMG_TR23532c13_g2_i5
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_superoxide_dismutase_[Cu-Zn]-like_[Amyelois_transitella]
Ontology
GO:0000187 P obsolete activation of MAPK activity
GO:0000303 P response to superoxide
GO:0001541 P ovarian follicle development
GO:0001819 P positive regulation of cytokine production
GO:0001895 P retina homeostasis
GO:0002262 P myeloid cell homeostasis
GO:0004784 F superoxide dismutase activity
GO:0005507 F copper ion binding
GO:0005615 C extracellular space
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006302 P double-strand break repair
GO:0006309 P apoptotic DNA fragmentation
GO:0006749 P glutathione metabolic process
GO:0006801 P superoxide metabolic process
GO:0006879 P cellular iron ion homeostasis
GO:0007283 P spermatogenesis
GO:0007566 P embryo implantation
GO:0007569 P cell aging
GO:0007605 P sensory perception of sound
GO:0007626 P locomotory behavior
GO:0008217 P regulation of blood pressure
GO:0008270 F zinc ion binding
GO:0009408 P response to heat
GO:0010033 P response to organic substance
GO:0016209 F antioxidant activity
GO:0016491 F oxidoreductase activity
GO:0019226 P transmission of nerve impulse
GO:0019430 P removal of superoxide radicals
GO:0030346 F protein phosphatase 2B binding
GO:0031012 C extracellular matrix
GO:0031410 C cytoplasmic vesicle
GO:0032287 P peripheral nervous system myelin maintenance
GO:0032839 C dendrite cytoplasm
GO:0040014 P regulation of multicellular organism growth
GO:0042493 P response to xenobiotic stimulus
GO:0042542 P response to hydrogen peroxide
GO:0043025 C neuronal cell body
GO:0043085 P positive regulation of catalytic activity
GO:0043234 C protein-containing complex
GO:0043524 P negative regulation of neuron apoptotic process
GO:0045471 P response to ethanol
GO:0045541 P negative regulation of cholesterol biosynthetic process
GO:0045859 P regulation of protein kinase activity
GO:0046716 P muscle cell cellular homeostasis
GO:0046872 F metal ion binding
GO:0048678 P response to axon injury
GO:0050665 P hydrogen peroxide biosynthetic process
GO:0051087 F chaperone binding
GO:0051881 P regulation of mitochondrial membrane potential
GO:0055114 P obsolete oxidation-reduction process
GO:0060047 P heart contraction
GO:0060052 P neurofilament cytoskeleton organization
GO:0060087 P relaxation of vascular associated smooth muscle
GO:0060088 P auditory receptor cell stereocilium organization
GO:0072593 P reactive oxygen species metabolic process
RNA-seq EntryA_TrvaFAMAMG_TR23532c13_g2_i5
Sequence
(Amino Acid)
MNLRGYLMFGQFLWLVAVLNGKTLQGIPGYGRNLVIKSLPAIEDYQSPIYEVYMEPYLYA
LGQTAYPLNANRAEKQIDLGMAPHSAPGLQAVVHLIPDEESGVSGDLIFTQIVPNGPVTI
EGNVTGLAPGLHGLHIHQIGDIKDNCKDIGPHFIAYYGRHGGPRDGIRHVGDLGNIKAEE
EVMKLKIVDHLISLAGPRSVVGRSIAITKGEDDYGRASTEDSALTGTSGPAVACGIIGYL
H
*(79 a.a.)

- SilkBase 1999-2023 -