SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG28979_internal:A_TrvaFAMAMG_TR23529c3_g8_i1
Scaffold_id
NCBI non-redundant
(nr)		Cyclin-G-associated_kinase_[Papilio_xuthus]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005925 C focal adhesion
GO:0006468 P protein phosphorylation
GO:0007029 P endoplasmic reticulum organization
GO:0007030 P Golgi organization
GO:0007049 P cell cycle
GO:0009913 P epidermal cell differentiation
GO:0010977 P negative regulation of neuron projection development
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0030054 C cell junction
GO:0031982 C vesicle
GO:0035622 P intrahepatic bile duct development
GO:0043231 C intracellular membrane-bounded organelle
GO:0048468 P cell development
GO:0048471 C perinuclear region of cytoplasm
GO:0048853 P forebrain morphogenesis
GO:0061436 P establishment of skin barrier
GO:0072318 P clathrin coat disassembly
GO:0072583 P clathrin-dependent endocytosis
GO:2000179 P positive regulation of neural precursor cell proliferation
RNA-seq EntryA_TrvaFAMAMG_TR23529c3_g8_i1
Sequence
(Amino Acid)
PTPAHRAPLLAPYYALLQHMYQYLAKDDRNAIVITCQDGKQMSCMLLCGLLLYSKLVTVP
EDALQIFAVKRSPINMPPSQLRYLYLLSNIIRPDPILPHFKPVSLISMTIQPVPLFTKAR
DGCRPYIEIYNEDRMVLSTLQDYDRLHMYTMAEGKVTLPLDSTVTGDVCVCVYHAR
(57 a.a.)

- SilkBase 1999-2023 -