SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG28864_complete:A_TrvaFAMAMG_TR23522c1_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		serine_protease_inhibitor_13_precursor_[Bombyx_mori]
Ontology
GO:0001300 P obsolete chronological cell aging
GO:0001525 P angiogenesis
GO:0002020 F protease binding
GO:0004857 F enzyme inhibitor activity
GO:0004867 F serine-type endopeptidase inhibitor activity
GO:0005102 F signaling receptor binding
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0010466 P negative regulation of peptidase activity
GO:0010469 P regulation of signaling receptor activity
GO:0010757 P negative regulation of plasminogen activation
GO:0010951 P negative regulation of endopeptidase activity
GO:0014912 P negative regulation of smooth muscle cell migration
GO:0030194 P positive regulation of blood coagulation
GO:0030336 P negative regulation of cell migration
GO:0030414 F peptidase inhibitor activity
GO:0031012 C extracellular matrix
GO:0032757 P positive regulation of interleukin-8 production
GO:0033629 P negative regulation of cell adhesion mediated by integrin
GO:0035375 F zymogen binding
GO:0035491 P positive regulation of leukotriene production involved in inflammatory response
GO:0045766 P positive regulation of angiogenesis
GO:0048260 P positive regulation of receptor-mediated endocytosis
GO:0050729 P positive regulation of inflammatory response
GO:0050829 P defense response to Gram-negative bacterium
GO:0051918 P negative regulation of fibrinolysis
GO:0061044 P negative regulation of vascular wound healing
GO:0070062 C extracellular exosome
GO:0071222 P cellular response to lipopolysaccharide
GO:0090026 P positive regulation of monocyte chemotaxis
GO:1902042 P negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:2000098 P negative regulation of smooth muscle cell-matrix adhesion
GO:2000352 P negative regulation of endothelial cell apoptotic process
RNA-seq EntryA_TrvaFAMAMG_TR23522c1_g1_i1
Sequence
(Amino Acid)
MVSLPYNDSTTVMYALKPRFPKRLSLTTLMKTLDYKKIDELISKMKRGKTIMRFPKMDLQ
GNIDLVKSLKALGIKTMFSPSEANFALMVDSSNNKTENEVIVKSRFGGEESRILQDTLNN
LPNPGLYVDSVLHNVKITVNEFGTVAVAASAGVLARTADQFNADSPFYMFIRNEKTKLIT
FSAIIFDPTK
*(62 a.a.)

- SilkBase 1999-2023 -