| Name | O_TrvaFAMAMG28290_3prime_partial:A_TrvaFAMAMG_TR23490c6_g4_i2 |
| Scaffold_id | |
NCBI non-redundant
(nr) | putative_s-syntaxin_[Danaus_plexippus] |
| Ontology |
| GO:0000149 |
F |
SNARE binding |
| GO:0005484 |
F |
SNAP receptor activity |
| GO:0005515 |
F |
protein binding |
| GO:0005886 |
C |
plasma membrane |
| GO:0006886 |
P |
intracellular protein transport |
| GO:0006903 |
P |
vesicle targeting |
| GO:0006906 |
P |
vesicle fusion |
| GO:0007340 |
P |
acrosome reaction |
| GO:0008021 |
C |
synaptic vesicle |
| GO:0016020 |
C |
membrane |
| GO:0016021 |
C |
integral component of membrane |
| GO:0016192 |
P |
vesicle-mediated transport |
| GO:0030033 |
P |
microvillus assembly |
| GO:0030133 |
C |
transport vesicle |
| GO:0030154 |
P |
cell differentiation |
| GO:0030496 |
C |
midbody |
| GO:0030855 |
P |
epithelial cell differentiation |
| GO:0031201 |
C |
SNARE complex |
| GO:0031629 |
P |
synaptic vesicle fusion to presynaptic active zone membrane |
| GO:0046907 |
P |
intracellular transport |
| GO:0048278 |
P |
vesicle docking |
| GO:0048546 |
P |
digestive tract morphogenesis |
|
| RNA-seq Entry | A_TrvaFAMAMG_TR23490c6_g4_i2 |
Sequence
(Amino Acid) | MREWISQLRDNTAHLRHIYSDPAYHANKQLQDRLDSLVTQSNALGLKICGALRQFESRVS
EGSAGAAVGWRIARLQYAVTRRLYADALEEHRRELDALRHNQLLLLQQQIKLTNLAVSEE
ECESLLDSNNIALFVDN
(44 a.a.) |
