SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG27661_internal:A_TrvaFAMAMG_TR23449c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_metabotropic_glutamate_receptor_5-like_[Amyelois_transitella]
Ontology
GO:0001641 F group II metabotropic glutamate receptor activity
GO:0004871 F obsolete signal transducer activity
GO:0004930 F G protein-coupled receptor activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007196 P adenylate cyclase-inhibiting G protein-coupled glutamate receptor signaling pathway
GO:0007216 P G protein-coupled glutamate receptor signaling pathway
GO:0007528 P neuromuscular junction development
GO:0008066 F glutamate receptor activity
GO:0015485 F cholesterol binding
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016595 F glutamate binding
GO:0038038 C G protein-coupled receptor homodimeric complex
GO:0045121 C membrane raft
GO:0051966 P regulation of synaptic transmission, glutamatergic
GO:0072553 P terminal button organization
RNA-seq EntryA_TrvaFAMAMG_TR23449c0_g1_i1
Sequence
(Amino Acid)
ASRLLTSRGQVWAWLGLSAPGWAAAAWSAARWSPLAQVVHPGQARAVLVCGGEEAMAQLF
PLAPALLLLGGCVVLAVRTRRLPHNLNETRFVGAAAYATCVTWLAFFPLYAVTEARTTCL
CTCASMS
(41 a.a.)

- SilkBase 1999-2023 -