SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG27387_internal:A_TrvaFAMAMG_TR23319c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_integrin_alpha-PS4-like_[Bombyx_mori]
Ontology
GO:0001656 P metanephros development
GO:0001822 P kidney development
GO:0005783 C endoplasmic reticulum
GO:0005886 C plasma membrane
GO:0005925 C focal adhesion
GO:0007155 P cell adhesion
GO:0007160 P cell-matrix adhesion
GO:0007229 P integrin-mediated signaling pathway
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007420 P brain development
GO:0007613 P memory
GO:0008305 C integrin complex
GO:0009986 C cell surface
GO:0014069 C postsynaptic density
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030030 P cell projection organization
GO:0030154 P cell differentiation
GO:0030198 P extracellular matrix organization
GO:0030511 P positive regulation of transforming growth factor beta receptor signaling pathway
GO:0032591 C dendritic spine membrane
GO:0034446 P substrate adhesion-dependent cell spreading
GO:0042472 P inner ear morphogenesis
GO:0043204 C perikaryon
GO:0045177 C apical part of cell
GO:0045184 P establishment of protein localization
GO:0046872 F metal ion binding
GO:0048333 P mesodermal cell differentiation
GO:0048745 P smooth muscle tissue development
GO:2000721 P positive regulation of transcription from RNA polymerase II promoter involved in smooth muscle cell differentiation
RNA-seq EntryA_TrvaFAMAMG_TR23319c0_g1_i1
Sequence
(Amino Acid)
NKEYDHNYWLGATVSSGSSFFVACAPLFTSTNNLDIGATGQCYISNDNLSMESLILSKDS
TKDLKLDDRISSYGWSLDVSEKDTISVGGPAMTSGRTLHYIKPDVFTGPKAMHGQDVKID
FNFGYSIASGNFASTSKLSYAVSSPYKYGEIVFFDEKWKVLKNKFKKPTVTWVRCSVLLY
ALLVC
(60 a.a.)

- SilkBase 1999-2023 -