SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG27377_complete:A_TrvaFAMAMG_TR23314c4_g1_i5
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_SWI/SNF-related_matrix-associated_actin-dependent_regulator_of_chromatin_subfamily_E_member_1_isoform_X7_[Bombyx_mori]
Ontology
GO:0000228 C nuclear chromosome
GO:0000790 C chromatin
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000980 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003713 F transcription coactivator activity
GO:0003723 F RNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006337 P nucleosome disassembly
GO:0006338 P chromatin remodeling
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007399 P nervous system development
GO:0008080 F N-acetyltransferase activity
GO:0016514 C SWI/SNF complex
GO:0016568 P chromatin organization
GO:0016922 F nuclear receptor binding
GO:0017053 C transcription repressor complex
GO:0022008 P neurogenesis
GO:0031492 F nucleosomal DNA binding
GO:0043044 P chromatin remodeling
GO:0043234 C protein-containing complex
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0047485 F protein N-terminus binding
GO:0071564 C npBAF complex
GO:0071565 C nBAF complex
GO:0090544 C SWI/SNF superfamily-type complex
RNA-seq EntryA_TrvaFAMAMG_TR23314c4_g1_i5
Sequence
(Amino Acid)
MQILKKQVQSLTMHQKKLEDELQQIEEKFEAKKRKFIESSEAFQEELKKHCKPAVDEETF
QRMVERALEQMRRGINPTSQSLSAVAQPDKKDEPMDQDQAVKQESNGPHPPTQVDKVSTS
DVKPDTNGSADIKVEENREKEPENGPTQTDAEGERKEEKPVDVKMENKESVPPAPVNQHP
APPHPQHMTSPPHHAMMMAPNQNPPHPGPPAHGGPPPAEEDPQPKKENE
*(75 a.a.)

- SilkBase 1999-2023 -