SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG27251_complete:A_TrvaFAMAMG_TR23293c0_g1_i3
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_uncharacterized_protein_LOC106139004_[Amyelois_transitella]
Ontology
GO:0000014 F single-stranded DNA endodeoxyribonuclease activity
GO:0000077 P DNA damage checkpoint signaling
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000724 P double-strand break repair via homologous recombination
GO:0001103 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001106 F transcription corepressor activity
GO:0001835 P blastocyst hatching
GO:0003677 F DNA binding
GO:0003684 F damaged DNA binding
GO:0004518 F nuclease activity
GO:0004519 F endonuclease activity
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005730 C nucleolus
GO:0006281 P DNA repair
GO:0006289 P nucleotide-excision repair
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0010792 P DNA double-strand break processing involved in repair via single-strand annealing
GO:0016787 F hydrolase activity
GO:0017053 C transcription repressor complex
GO:0031572 P mitotic G2 DNA damage checkpoint signaling
GO:0032355 P response to estradiol
GO:0051301 P cell division
GO:0051321 P meiotic cell cycle
GO:0090305 P nucleic acid phosphodiester bond hydrolysis
RNA-seq EntryA_TrvaFAMAMG_TR23293c0_g1_i3
Sequence
(Amino Acid)
MDLGMSTKRKDMENIKRKLPEQAVEPFYKEPTVRKKSEKMALPGWVCDECRNFFGVIYRD
DPTKLAEAIERCSKHRGKNNPARPKTPPNYWNPRWNVPDNTEELNRMNNAL
*(36 a.a.)

- SilkBase 1999-2023 -