SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG2700_3prime_partial:A_TrvaFAMAMG_TR3490c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_SOX_domain-containing_protein_dichaete-like_[Papilio_xuthus]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0002168 P instar larval development
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003730 F mRNA 3'-UTR binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007350 P blastoderm segmentation
GO:0007411 P axon guidance
GO:0007417 P central nervous system development
GO:0007420 P brain development
GO:0007442 P hindgut morphogenesis
GO:0008134 F transcription factor binding
GO:0008301 F DNA binding, bending
GO:0009950 P dorsal/ventral axis specification
GO:0010468 P regulation of gene expression
GO:0014019 P neuroblast development
GO:0035120 P post-embryonic appendage morphogenesis
GO:0043565 F sequence-specific DNA binding
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0060810 P intracellular mRNA localization involved in pattern specification process
GO:0070983 P dendrite guidance
RNA-seq EntryA_TrvaFAMAMG_TR3490c0_g1_i1
Sequence
(Amino Acid)
MSTLSHHPYAFSMHPGMLPDYPSAPQQIPATSPQSEGHIKRPMNAFMVWSRLQRRQIAKD
NPKMHNSEISKRLGAEWKLLSEMQKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKPPTQG
GAPGAGAFPSFPLPYFAGPAPTVGHLDALSYPAVPPYFPHQLDHLQFSKLMAPTAEKLPT
VSSSAAAVVS
(62 a.a.)

- SilkBase 1999-2023 -