SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG269_complete:A_TrvaFAMAMG_TR537c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_protein_arginine_N-methyltransferase_6_[Bombyx_mori]
Ontology
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006355 P regulation of transcription, DNA-templated
GO:0006479 P protein methylation
GO:0008168 F methyltransferase activity
GO:0008469 F histone-arginine N-methyltransferase activity
GO:0016274 F protein-arginine N-methyltransferase activity
GO:0016571 P histone methylation
GO:0016740 F transferase activity
GO:0019919 P peptidyl-arginine methylation, to asymmetrical-dimethyl arginine
GO:0030331 F estrogen receptor binding
GO:0032088 P negative regulation of NF-kappaB transcription factor activity
GO:0032259 P methylation
GO:0034969 P histone arginine methylation
GO:0035189 C Rb-E2F complex
GO:0035242 F protein-arginine omega-N asymmetric methyltransferase activity
GO:0035246 P peptidyl-arginine N-methylation
GO:0042054 F histone methyltransferase activity
GO:0043065 P positive regulation of apoptotic process
GO:0043433 P negative regulation of DNA-binding transcription factor activity
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0048588 P developmental cell growth
GO:0060765 P regulation of androgen receptor signaling pathway
GO:2000134 P negative regulation of G1/S transition of mitotic cell cycle
RNA-seq EntryA_TrvaFAMAMG_TR537c0_g1_i1
Sequence
(Amino Acid)
MKSFAKQLRKSKCTKPEILTIQQDDLLGEEVAMCWINLREDFASDLDVFTIQHVVGAKKS
GLYQGLCLWFECNFPSLCDTKDEDRIILDTSPKSPGTHWKQTVIVLPQEVQVDEGEPIAF
QLDMKRDTEHNRRYNLQMTLLDPEAVDHPQPCSCHMTKCILVKAFMEKH
*(55 a.a.)

- SilkBase 1999-2023 -