| Name | O_TrvaFAMAMG26577_internal:A_TrvaFAMAMG_TR23092c0_g1_i1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | PREDICTED:_ras-related_and_estrogen-regulated_growth_inhibitor-like_protein_[Amyelois_transitella] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0003924 |
F |
GTPase activity |
| GO:0005525 |
F |
GTP binding |
| GO:0005622 |
C |
intracellular anatomical structure |
| GO:0005634 |
C |
nucleus |
| GO:0005737 |
C |
cytoplasm |
| GO:0005829 |
C |
cytosol |
| GO:0007165 |
P |
signal transduction |
| GO:0007264 |
P |
small GTPase mediated signal transduction |
| GO:0008152 |
P |
metabolic process |
| GO:0008285 |
P |
negative regulation of cell population proliferation |
| GO:0009725 |
P |
response to hormone |
| GO:0015031 |
P |
protein transport |
| GO:0016020 |
C |
membrane |
| GO:0030308 |
P |
negative regulation of cell growth |
|
| RNA-seq Entry | A_TrvaFAMAMG_TR23092c0_g1_i1 |
Sequence
(Amino Acid) | GAVSEVEILDTSNCAIRGCLGEHVRWGDAFAVVYSVCERRSFLAAAELLSLLERTRLPGC
AAVTLLGNKRDLEHAREVHAEEGQELSLRFGCQFYEVFAAESCAGAA
(34 a.a.) |
