SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG26412_complete:A_TrvaFAMAMG_TR23045c0_g2_i3
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_TGF-beta_receptor_type-1_isoform_X4_[Bombyx_mori]
Ontology
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000166 F nucleotide binding
GO:0001701 P in utero embryonic development
GO:0001942 P hair follicle development
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004675 F transmembrane receptor protein serine/threonine kinase activity
GO:0004702 F obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006355 P regulation of transcription, DNA-templated
GO:0006468 P protein phosphorylation
GO:0007165 P signal transduction
GO:0007178 P transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0007417 P central nervous system development
GO:0009966 P regulation of signal transduction
GO:0009986 C cell surface
GO:0010628 P positive regulation of gene expression
GO:0010629 P negative regulation of gene expression
GO:0010862 P positive regulation of pathway-restricted SMAD protein phosphorylation
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016361 F activin receptor activity, type I
GO:0016740 F transferase activity
GO:0017002 F activin-activated receptor activity
GO:0018107 P peptidyl-threonine phosphorylation
GO:0019838 F growth factor binding
GO:0023014 P signal transduction
GO:0030308 P negative regulation of cell growth
GO:0031625 F ubiquitin protein ligase binding
GO:0032924 P activin receptor signaling pathway
GO:0032927 P positive regulation of activin receptor signaling pathway
GO:0034711 F inhibin binding
GO:0038092 P nodal signaling pathway
GO:0043235 C receptor complex
GO:0045648 P positive regulation of erythrocyte differentiation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046332 F SMAD binding
GO:0046545 P development of primary female sexual characteristics
GO:0046777 P protein autophosphorylation
GO:0046872 F metal ion binding
GO:0048179 C activin receptor complex
GO:0048185 F activin binding
GO:0070062 C extracellular exosome
GO:0097191 P extrinsic apoptotic signaling pathway
GO:1901165 P positive regulation of trophoblast cell migration
RNA-seq EntryA_TrvaFAMAMG_TR23045c0_g2_i3
Sequence
(Amino Acid)
MFMGGNVIMSTIRLEKWVPLLIFFVYRMLDAVDALKCYCNNKGCPNSTCETDGYCFASAS
FENGGPKYQYQCWDRQNIFPPGDMPVWCREDERSDIICCASDYCNRDIFAGTVRVRNVSS
GRVVWAAFL
*(42 a.a.)

- SilkBase 1999-2023 -