EntryView

ORF from Assembled RNA_seq Entry

Name

O_TrvaFAMAMG25514_5prime_partial:A_TrvaFAMAMG_TR22678c0_g1_i1

Scaffold_id

NCBI non-redundant
(nr)

annexin_x_[Anopheles_darlingi]

Ontology

GO:0001725	C	stress fiber
GO:0001786	F	phosphatidylserine binding
GO:0003418	P	growth plate cartilage chondrocyte differentiation
GO:0004872	F	signaling receptor activity
GO:0005262	F	calcium channel activity
GO:0005509	F	calcium ion binding
GO:0005525	F	GTP binding
GO:0005544	F	calcium-dependent phospholipid binding
GO:0005737	C	cytoplasm
GO:0005739	C	mitochondrion
GO:0005765	C	lysosomal membrane
GO:0005829	C	cytosol
GO:0005886	C	plasma membrane
GO:0005925	C	focal adhesion
GO:0006816	P	calcium ion transport
GO:0006937	P	regulation of muscle contraction
GO:0008201	F	heparin binding
GO:0008289	F	lipid binding
GO:0015276	F	ligand-gated ion channel activity
GO:0015485	F	cholesterol binding
GO:0016020	C	membrane
GO:0016021	C	integral component of membrane
GO:0019899	F	enzyme binding
GO:0030061	C	mitochondrial crista
GO:0031214	P	biomineral tissue development
GO:0031902	C	late endosome membrane
GO:0031988	C	vesicle
GO:0034220	P	ion transmembrane transport
GO:0035374	F	chondroitin sulfate binding
GO:0042470	C	melanosome
GO:0042584	C	chromaffin granule membrane
GO:0042802	F	identical protein binding
GO:0042803	F	protein homodimerization activity
GO:0048306	F	calcium-dependent protein binding
GO:0048471	C	perinuclear region of cytoplasm
GO:0051015	F	actin filament binding
GO:0051260	P	protein homooligomerization
GO:0051283	P	negative regulation of sequestering of calcium ion
GO:0051560	P	mitochondrial calcium ion homeostasis
GO:0070062	C	extracellular exosome
GO:0070509	P	calcium ion import
GO:0070588	P	calcium ion transmembrane transport
GO:0097190	P	apoptotic signaling pathway

RNA-seq Entry

Sequence
(Amino Acid)

QTERNGSSWRRPMPEVYHRSLLEDIQSDCSGIFLELLKLIVSGSRTDEGATDPEKAHQEA
QKLSENLNVWTTFKNPDTYMRVRQTQKYFLTKMKTTDFFILQDR
*(34 a.a.)

- SilkBase 1999-2023 -