SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG25441_internal:A_TrvaFAMAMG_TR22565c0_g2_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_synembryn_[Bombyx_mori]
Ontology
GO:0001965 F G-protein alpha-subunit binding
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005096 F GTPase activator activity
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005938 C cell cortex
GO:0007163 P establishment or maintenance of cell polarity
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0007369 P gastrulation
GO:0008105 P protein localization
GO:0008356 P asymmetric cell division
GO:0010004 P gastrulation involving germ band extension
GO:0040001 P establishment of mitotic spindle localization
GO:0043547 P positive regulation of GTPase activity
GO:0050821 P protein stabilization
GO:0055057 P neuroblast division
RNA-seq EntryA_TrvaFAMAMG_TR22565c0_g2_i1
Sequence
(Amino Acid)
LNCFILQEKENLYEKLSPILTVLNKCARVRVQRKFLRQAVLPPLRDISKPPEQGNELRNR
LCKLLTSPVTTVRDLVAEFLFVLCKEKVSRMVKYTGFGNAAGHLVNRGLLAGGCGGRGGR
(39 a.a.)

- SilkBase 1999-2023 -