SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG25330_complete:A_TrvaFAMAMG_TR22207c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_inhibin_beta_A_chain-like_[Bombyx_mori]
Ontology
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0001541 P ovarian follicle development
GO:0002244 P hematopoietic progenitor cell differentiation
GO:0005125 F cytokine activity
GO:0005160 F transforming growth factor beta receptor binding
GO:0005179 F hormone activity
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007050 P regulation of cell cycle
GO:0007498 P mesoderm development
GO:0008083 F growth factor activity
GO:0008285 P negative regulation of cell population proliferation
GO:0008584 P male gonad development
GO:0010862 P positive regulation of pathway-restricted SMAD protein phosphorylation
GO:0030308 P negative regulation of cell growth
GO:0032924 P activin receptor signaling pathway
GO:0040007 P growth
GO:0042493 P response to xenobiotic stimulus
GO:0042541 P hemoglobin biosynthetic process
GO:0042701 P progesterone secretion
GO:0042981 P regulation of apoptotic process
GO:0043408 P regulation of MAPK cascade
GO:0043509 C activin A complex
GO:0043512 C inhibin A complex
GO:0045648 P positive regulation of erythrocyte differentiation
GO:0045786 P negative regulation of cell cycle
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046880 P regulation of follicle-stimulating hormone secretion
GO:0048468 P cell development
GO:0060021 P roof of mouth development
GO:0060395 P SMAD protein signal transduction
GO:2001241 P positive regulation of extrinsic apoptotic signaling pathway in absence of ligand
RNA-seq EntryA_TrvaFAMAMG_TR22207c0_g1_i1
Sequence
(Amino Acid)
MISWLTRVLVFILVSNFSSLDGEMLGSCANCANGDLSITELTEARIEFVKQQILKKLRMS
KKPAVALPVNSLPMPVAQGQTLSEGTDKPAEFDDYYGRTEQKIIFPVEGECLTSGRYPFK
CLQFELPPDVEPEEVSVVELWFYKERDPFDEYNQTFVISEAAHWDSQQQFKKTKPIAIKE
TDVGEGWVRVELAWAVRVWLEGRQRLHTLHVACRTCQLRRAPLSFHEKHRPFLVLYTKYA
GKRRRGRALECTSETNECCREPLYISFKELGWDYWIIRPAGYHAYFCKGSCAPISAVTSS
KSYHHNMLRKYFYTVSEKVAEFKPCCAPTTFSSLQLLYIDSKNTVTQKTLPNMVVESCGC
M
*(119 a.a.)

- SilkBase 1999-2023 -