SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG25283_internal:A_TrvaFAMAMG_TR22105c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_lachesin-like_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001934 P positive regulation of protein phosphorylation
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004714 F transmembrane receptor protein tyrosine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005886 C plasma membrane
GO:0006468 P protein phosphorylation
GO:0007275 P multicellular organism development
GO:0007528 P neuromuscular junction development
GO:0007613 P memory
GO:0008582 P regulation of synaptic assembly at neuromuscular junction
GO:0009897 C external side of plasma membrane
GO:0010628 P positive regulation of gene expression
GO:0010629 P negative regulation of gene expression
GO:0014850 P response to muscle activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0019901 F protein kinase binding
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0031594 C neuromuscular junction
GO:0032224 P positive regulation of synaptic transmission, cholinergic
GO:0042995 C cell projection
GO:0043113 P receptor clustering
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0045887 P positive regulation of synaptic assembly at neuromuscular junction
GO:0046777 P protein autophosphorylation
GO:0046872 F metal ion binding
GO:0048678 P response to axon injury
GO:0050731 P positive regulation of peptidyl-tyrosine phosphorylation
GO:0051602 P response to electrical stimulus
GO:0060041 P retina development in camera-type eye
GO:0060291 P long-term synaptic potentiation
GO:0090102 P cochlea development
RNA-seq EntryA_TrvaFAMAMG_TR22105c0_g1_i1
Sequence
(Amino Acid)
STALAAANSGKHGGVEFPEFGQPITNLTVPLGRDATFECIVVNLGNFRVGWVKADTKAIQ
AIHEHVITHNPRVSVSHSDHSTWYLHIKNVQEEDRGQYMCQINTDPMKSQMG
(36 a.a.)

- SilkBase 1999-2023 -