SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG24454_internal:A_TrvaFAMAMG_TR21415c1_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_ras-specific_guanine_nucleotide-releasing_factor_1-like,_partial_[Papilio_xuthus]
Ontology
GO:0000165 P MAPK cascade
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005088 F guanyl-nucleotide exchange factor activity
GO:0005089 F guanyl-nucleotide exchange factor activity
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0007165 P signal transduction
GO:0007264 P small GTPase mediated signal transduction
GO:0007616 P long-term memory
GO:0008283 P cell population proliferation
GO:0030426 C growth cone
GO:0031175 P neuron projection development
GO:0035020 P regulation of Rac protein signal transduction
GO:0035023 P regulation of Rho protein signal transduction
GO:0035254 F glutamate receptor binding
GO:0035556 P intracellular signal transduction
GO:0043005 C neuron projection
GO:0043547 P positive regulation of GTPase activity
GO:0046578 P regulation of Ras protein signal transduction
GO:0046579 P positive regulation of Ras protein signal transduction
GO:0048167 P regulation of synaptic plasticity
GO:0048168 P regulation of neuronal synaptic plasticity
GO:0090630 P activation of GTPase activity
GO:2000310 P regulation of NMDA receptor activity
RNA-seq EntryA_TrvaFAMAMG_TR21415c1_g1_i1
Sequence
(Amino Acid)
AGYLHKRSADNTKWQLRWFVLYQNILFYYESENNSRPTGVLLLEGSYCERLSKSPMERNA
SFCFTISYRRESQRQYELRAASEVDCVHWVDAIREASFNKLLLQKEELEQKQLHLLQVVE
SERTSRWQYAQQC
(43 a.a.)

- SilkBase 1999-2023 -