SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG24266_internal:A_TrvaFAMAMG_TR20972c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_uncharacterized_protein_LOC106135922_[Amyelois_transitella]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000166 F nucleotide binding
GO:0002024 P diet induced thermogenesis
GO:0003779 F actin binding
GO:0005034 F osmosensor activity
GO:0005080 F protein kinase C binding
GO:0005216 F ion channel activity
GO:0005261 F cation channel activity
GO:0005262 F calcium channel activity
GO:0005515 F protein binding
GO:0005516 F calmodulin binding
GO:0005524 F ATP binding
GO:0005881 C cytoplasmic microtubule
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0005925 C focal adhesion
GO:0005929 C cilium
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006816 P calcium ion transport
GO:0006874 P cellular calcium ion homeostasis
GO:0006884 P cell volume homeostasis
GO:0006970 P response to osmotic stress
GO:0006971 P hypotonic response
GO:0007015 P actin filament organization
GO:0007043 P cell-cell junction assembly
GO:0007204 P positive regulation of cytosolic calcium ion concentration
GO:0007231 P osmosensory signaling pathway
GO:0008017 F microtubule binding
GO:0009612 P response to mechanical stimulus
GO:0009986 C cell surface
GO:0010628 P positive regulation of gene expression
GO:0010759 P positive regulation of macrophage chemotaxis
GO:0010977 P negative regulation of neuron projection development
GO:0015275 F stretch-activated, cation-selective, calcium channel activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0019901 F protein kinase binding
GO:0030027 C lamellipodium
GO:0030054 C cell junction
GO:0030103 P vasopressin secretion
GO:0030175 C filopodium
GO:0030426 C growth cone
GO:0030864 C cortical actin cytoskeleton
GO:0031117 P positive regulation of microtubule depolymerization
GO:0031410 C cytoplasmic vesicle
GO:0031532 P actin cytoskeleton reorganization
GO:0032587 C ruffle membrane
GO:0032868 P response to insulin
GO:0034605 P cellular response to heat
GO:0042169 F SH2 domain binding
GO:0042538 P hyperosmotic salinity response
GO:0042593 P glucose homeostasis
GO:0042995 C cell projection
GO:0043014 F alpha-tubulin binding
GO:0043117 P positive regulation of vascular permeability
GO:0043622 P cortical microtubule organization
GO:0046330 P positive regulation of JNK cascade
GO:0046785 P microtubule polymerization
GO:0047484 P regulation of response to osmotic stress
GO:0048487 F beta-tubulin binding
GO:0050729 P positive regulation of inflammatory response
GO:0050891 P multicellular organismal water homeostasis
GO:0051015 F actin filament binding
GO:0055085 P transmembrane transport
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:0070509 P calcium ion import
GO:0070588 P calcium ion transmembrane transport
GO:0071470 P cellular response to osmotic stress
GO:0071476 P cellular hypotonic response
GO:0071477 P cellular hypotonic salinity response
GO:0071639 P positive regulation of monocyte chemotactic protein-1 production
GO:0071642 P positive regulation of macrophage inflammatory protein 1 alpha production
GO:0071651 P positive regulation of chemokine (C-C motif) ligand 5 production
GO:0097497 P blood vessel endothelial cell delamination
GO:1903444 P negative regulation of brown fat cell differentiation
GO:1903759 P obsolete signal transduction involved in regulation of aerobic respiration
GO:2000340 P positive regulation of chemokine (C-X-C motif) ligand 1 production
GO:2000507 P energy homeostasis
GO:2000778 P positive regulation of interleukin-6 production
RNA-seq EntryA_TrvaFAMAMG_TR20972c0_g1_i1
Sequence
(Amino Acid)
CIPARLLQETNVEEAILLFLLPGSWFLLMFFAGAVKLTGPFVTMIYSMITGDMFTFGIIY
CIVLFGFSQSFYFLYRGFPNVQSTLYSSYPSTWMALFQITLGDYSYSDLSLTTYPNLSKT
VFTIFMIFVPILLLNMLIAMMGNTYAHVIEQSEKEWVKQWAKIVVSLERSVAQDDAHKYL
QEYSIGLGPSDDPRYEQRAVMVIKSKAKTRAKQKKDALTNWKHVGKVTIAELRRRGISGE
ELRRLMWGRVSISTPTKAPARRAPAPPPDCVVSSEVGLAGDVGNGVAPALSSALNVMAFT
HELDLGTTGPDQKPTPDLLVTSKASNVPILSPTTQTQTITTNTPGAPTLPTRVEPSQHKT
ALDPRLDPTMSSLPIQSNVGNVPGTGVRASTGQPLAIPEIQQPKEIQKPEQIYQDYL
(138 a.a.)

- SilkBase 1999-2023 -