SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG24045_5prime_partial:A_TrvaFAMAMG_TR20614c0_g2_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_fork_head_domain_transcription_factor_slp2_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001541 P ovarian follicle development
GO:0002074 P extraocular skeletal muscle development
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006309 P apoptotic DNA fragmentation
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007338 P single fertilization
GO:0008585 P female gonad development
GO:0019101 P female somatic sex determination
GO:0030154 P cell differentiation
GO:0030331 F estrogen receptor binding
GO:0031624 F ubiquitin conjugating enzyme binding
GO:0033686 P positive regulation of luteinizing hormone secretion
GO:0042703 P menstruation
GO:0043028 F cysteine-type endopeptidase regulator activity involved in apoptotic process
GO:0043065 P positive regulation of apoptotic process
GO:0043280 P positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043565 F sequence-specific DNA binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046881 P positive regulation of follicle-stimulating hormone secretion
GO:0048048 P embryonic eye morphogenesis
GO:0060014 P granulosa cell differentiation
GO:0060065 P uterus development
RNA-seq EntryA_TrvaFAMAMG_TR20614c0_g2_i1
Sequence
(Amino Acid)
SKAKMAAKNESEKWRRRKLNKNVDNDNDCASLAWLLNFRLDEVVKVRVPDDEPVVKEAKV
VVETPAIRKPPYTYPELIEQALRENGELTVSGIYQWISDRFPFFKANDERWKNSVRHNLS
INPHFRKGARASQGAGHLWSLAANAIDLLPLRNTPIHEEKTPEPMQTAKIIGFPKVIVLD
EAAIAAASIIPDQDLFSGSTMFLNPVSAEQVIRECGLITVD
*(73 a.a.)

- SilkBase 1999-2023 -