SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG24019_internal:A_TrvaFAMAMG_TR20466c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_kin_of_IRRE-like_protein_3_[Plutella_xylostella]
Ontology
GO:0001878 P response to yeast
GO:0002224 P toll-like receptor signaling pathway
GO:0002250 P adaptive immune response
GO:0002309 P T cell proliferation involved in immune response
GO:0002376 P immune system process
GO:0002668 P negative regulation of T cell anergy
GO:0005102 F signaling receptor binding
GO:0005886 C plasma membrane
GO:0007568 P aging
GO:0009897 C external side of plasma membrane
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0032496 P response to lipopolysaccharide
GO:0034138 P toll-like receptor 3 signaling pathway
GO:0034341 P response to interferon-gamma
GO:0042102 P positive regulation of T cell proliferation
GO:0042104 P positive regulation of activated T cell proliferation
GO:0042113 P B cell activation
GO:0042493 P response to xenobiotic stimulus
GO:0043011 P myeloid dendritic cell differentiation
GO:0043231 C intracellular membrane-bounded organelle
GO:0051607 P defense response to virus
GO:0070062 C extracellular exosome
GO:0071222 P cellular response to lipopolysaccharide
GO:0071248 P cellular response to metal ion
GO:0071345 P cellular response to cytokine stimulus
RNA-seq EntryA_TrvaFAMAMG_TR20466c0_g1_i1
Sequence
(Amino Acid)
KNLKNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAQHKPRSEEWALRIRSPQRRDSGQYEC
QISTTPPIGHAVFLNIVEPETEILGGPDIFIYAGSTINLTCIV
(33 a.a.)

- SilkBase 1999-2023 -