| Name | O_TrvaFAMAMG23975_complete:A_TrvaFAMAMG_TR20341c0_g1_i1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | vacuolar_protein_sorting-associated_protein_37A_[Bombyx_mori] |
| Ontology |
| GO:0000813 |
C |
ESCRT I complex |
| GO:0005515 |
F |
protein binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0005768 |
C |
endosome |
| GO:0005886 |
C |
plasma membrane |
| GO:0006810 |
P |
transport |
| GO:0006914 |
P |
autophagy |
| GO:0010008 |
C |
endosome membrane |
| GO:0015031 |
P |
protein transport |
| GO:0016020 |
C |
membrane |
| GO:0016197 |
P |
endosomal transport |
| GO:0019058 |
P |
viral life cycle |
| GO:0030496 |
C |
midbody |
| GO:0031902 |
C |
late endosome membrane |
| GO:0036258 |
P |
multivesicular body assembly |
| GO:0039702 |
P |
viral budding via host ESCRT complex |
| GO:0048306 |
F |
calcium-dependent protein binding |
| GO:0070062 |
C |
extracellular exosome |
| GO:0075733 |
P |
intracellular transport of virus |
| GO:1902188 |
P |
obsolete positive regulation of viral release from host cell |
| GO:1903774 |
P |
positive regulation of viral budding via host ESCRT complex |
|
| RNA-seq Entry | A_TrvaFAMAMG_TR20341c0_g1_i1 |
Sequence
(Amino Acid) | MIQSDYPSVMSAMGLLTHLNSDELKELLNDDVKFESILKNANQVKDAEKEMVIASNRSLA
EFNLSKEPELERMKVELQEKSELGEQICTRIQELLNEYKTKSAGISPDTTHALLQTAAAE
SEEQSDNIARDFLSGKMGVDKFLEDFESIRKQMHIRKYKAEKMSELLRNNSSRIPYGNGA
TKPHLPYPSYIPTSHPSLPYPEGPLNMPMPGMYGNHF
*(71 a.a.) |
