SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG2393_5prime_partial:A_TrvaFAMAMG_TR3342c1_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_5-hydroxytryptamine_receptor_1A-beta-like_[Amyelois_transitella]
Ontology
GO:0001659 P temperature homeostasis
GO:0001965 F G-protein alpha-subunit binding
GO:0004871 F obsolete signal transducer activity
GO:0004930 F G protein-coupled receptor activity
GO:0004993 F G protein-coupled serotonin receptor activity
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005901 C caveola
GO:0006874 P cellular calcium ion homeostasis
GO:0006939 P smooth muscle contraction
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007202 P activation of phospholipase C activity
GO:0007204 P positive regulation of cytosolic calcium ion concentration
GO:0007208 P phospholipase C-activating serotonin receptor signaling pathway
GO:0007210 P serotonin receptor signaling pathway
GO:0007568 P aging
GO:0007610 P behavior
GO:0007613 P memory
GO:0008144 F obsolete drug binding
GO:0008219 P cell death
GO:0008284 P positive regulation of cell population proliferation
GO:0010513 P positive regulation of phosphatidylinositol biosynthetic process
GO:0014059 P regulation of dopamine secretion
GO:0014065 P phosphatidylinositol 3-kinase signaling
GO:0014824 P artery smooth muscle contraction
GO:0014832 P urinary bladder smooth muscle contraction
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016023 C cytoplasmic vesicle
GO:0019233 P sensory perception of pain
GO:0030424 C axon
GO:0030425 C dendrite
GO:0030431 P sleep
GO:0031410 C cytoplasmic vesicle
GO:0032403 F protein-containing complex binding
GO:0033674 P positive regulation of kinase activity
GO:0042493 P response to xenobiotic stimulus
GO:0042995 C cell projection
GO:0043025 C neuronal cell body
GO:0043198 C dendritic shaft
GO:0043267 P negative regulation of potassium ion transport
GO:0043406 P positive regulation of MAP kinase activity
GO:0044380 P protein localization to cytoskeleton
GO:0045600 P positive regulation of fat cell differentiation
GO:0045821 P positive regulation of glycolytic process
GO:0045907 P positive regulation of vasoconstriction
GO:0046883 P regulation of hormone secretion
GO:0048148 P behavioral response to cocaine
GO:0050731 P positive regulation of peptidyl-tyrosine phosphorylation
GO:0050795 P regulation of behavior
GO:0050965 P detection of temperature stimulus involved in sensory perception of pain
GO:0050966 P detection of mechanical stimulus involved in sensory perception of pain
GO:0051209 P release of sequestered calcium ion into cytosol
GO:0051378 F serotonin binding
GO:0051967 P negative regulation of synaptic transmission, glutamatergic
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:0070852 C cell body fiber
GO:0071886 F 1-(4-iodo-2,5-dimethoxyphenyl)propan-2-amine binding
RNA-seq EntryA_TrvaFAMAMG_TR3342c1_g1_i1
Sequence
(Amino Acid)
HRPRSASDDESNDGLLAPSNLTTKSRSSEDGLLLPPPCTCPYFGSESTPPRRTTEVIIVP
GGDINGCNGFSKNGNLNEPSTPIFRRSSRGASSMVTWDEARRFRRGSSFGGARTTLSTPV
RSIRTQRSMRSQTNTPQRQIPRTHHSRNSSVISRNSSRHGRILRLEQKATKVLGVVFFTF
VVLWAPFFILNMVPAVCPDCEGKIAHWVFDFALWLGYASSMVNPIFYTIFNKVFRQAFKK
VLRCQYCKYRR
*(83 a.a.)

- SilkBase 1999-2023 -