SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG23422_5prime_partial:A_TrvaFAMAMG_TR19851c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		small_heat_shock_protein_G4_[Helicoverpa_armigera]
Ontology
GO:0001666 P response to hypoxia
GO:0002088 P lens development in camera-type eye
GO:0005212 F structural constituent of eye lens
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0007021 P tubulin complex assembly
GO:0007517 P muscle organ development
GO:0010629 P negative regulation of gene expression
GO:0010941 P regulation of cell death
GO:0030018 C Z disc
GO:0032387 P negative regulation of intracellular transport
GO:0042542 P response to hydrogen peroxide
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0043010 P camera-type eye development
GO:0043066 P negative regulation of apoptotic process
GO:0043154 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043209 C myelin sheath
GO:0043292 C contractile fiber
GO:0046872 F metal ion binding
GO:0051082 F unfolded protein binding
GO:0051260 P protein homooligomerization
GO:0060561 P apoptotic process involved in morphogenesis
GO:0070062 C extracellular exosome
GO:0071480 P cellular response to gamma radiation
RNA-seq EntryA_TrvaFAMAMG_TR19851c0_g1_i1
Sequence
(Amino Acid)
APRVPRFSYITSHTCAGLSSTYILDLYTRANKMFSPRLFAVICVCFATVSALPARDKPIP
PPITTIDDQFTFPWLNLSPFSLFAPLWKLIPTFVDIGPRIYADEKQFQVVINVKDYQKEN
LKVRVKGDFIFVQGSQEVKDDTHDLFASDFLHTYSKPANTSAQAVTAKLTSDKYLIVTAP
IGETVEETTTAERVVPIEETGAPYKKEETEEKATESAEVTTTQEAKTSAPEVTTPPEIEE
KKETTSPPEQDEATEKDNVIPHGNEVSA
*(88 a.a.)

- SilkBase 1999-2023 -