SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG2315_3prime_partial:A_TrvaFAMAMG_TR3327c1_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_FGFR1_oncogene_partner-like_[Bombyx_mori]
Ontology
GO:0000086 P G2/M transition of mitotic cell cycle
GO:0004713 F protein tyrosine kinase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0006469 P negative regulation of protein kinase activity
GO:0008284 P positive regulation of cell population proliferation
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0019901 F protein kinase binding
GO:0030292 F protein tyrosine kinase inhibitor activity
GO:0030307 P positive regulation of cell growth
GO:0030335 P positive regulation of cell migration
GO:0034453 P microtubule anchoring
GO:0042803 F protein homodimerization activity
GO:0048471 C perinuclear region of cytoplasm
GO:0061099 P negative regulation of protein tyrosine kinase activity
RNA-seq EntryA_TrvaFAMAMG_TR3327c1_g1_i1
Sequence
(Amino Acid)
MAQSEDTELRDLVIEALEKNGSLAKIRALLRANVFLAFEEDCDIKQNPSLDNIFNLPEDN
SSDDKNKLHLRLNLDNSDTDTSSESARDKSSSEYIPGDHILQMQ
(33 a.a.)

- SilkBase 1999-2023 -