SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG23139_complete:A_TrvaFAMAMG_TR19431c0_g2_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_NADPH_oxidase_4-like_[Bombyx_mori]
Ontology
GO:0001525 P angiogenesis
GO:0003081 P regulation of systemic arterial blood pressure by renin-angiotensin
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005886 C plasma membrane
GO:0006801 P superoxide metabolic process
GO:0008284 P positive regulation of cell population proliferation
GO:0010575 P positive regulation of vascular endothelial growth factor production
GO:0015992 P proton transmembrane transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016175 F superoxide-generating NAD(P)H oxidase activity
GO:0016477 P cell migration
GO:0016491 F oxidoreductase activity
GO:0030054 C cell junction
GO:0030171 F voltage-gated proton channel activity
GO:0030198 P extracellular matrix organization
GO:0042554 P superoxide anion generation
GO:0042743 P hydrogen peroxide metabolic process
GO:0042995 C cell projection
GO:0043020 C NADPH oxidase complex
GO:0043410 P positive regulation of MAPK cascade
GO:0045726 P positive regulation of integrin biosynthetic process
GO:0046330 P positive regulation of JNK cascade
GO:0046872 F metal ion binding
GO:0048365 F small GTPase binding
GO:0051454 P intracellular pH elevation
GO:0055114 P obsolete oxidation-reduction process
GO:0071438 C obsolete invadopodium membrane
GO:0071455 P cellular response to hyperoxia
GO:0072592 P oxygen metabolic process
GO:1902177 P positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
GO:1990451 P cellular stress response to acidic pH
RNA-seq EntryA_TrvaFAMAMG_TR19431c0_g2_i1
Sequence
(Amino Acid)
MEGVSRSEVAICVAAGVGITPFVPVLHYLLHNPRSSLPGRVHLIWIVKNENELTWLADLA
NKTIQELRTANRPDRLHLEFYITRDKQTKEHTVFINDHGSLTHVVKENVVDEKATLLTPN
KKRNSYAKVDCSYSLVKEYPVLGCRVRRGRPYWDRVFGYWVHFYPESHLNLYCCGPKKLV
RSLRSKCISTSRSTKTKFTFVHEGFT
*(68 a.a.)

- SilkBase 1999-2023 -