SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG23050_3prime_partial:A_TrvaFAMAMG_TR19300c0_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_serine/threonine-protein_kinase_grp_isoform_X2_[Bombyx_mori]
Ontology
GO:0000077 P DNA damage checkpoint signaling
GO:0000166 F nucleotide binding
GO:0000785 C chromatin
GO:0000794 C condensed nuclear chromosome
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005575 C cellular_component
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0006281 P DNA repair
GO:0006468 P protein phosphorylation
GO:0006974 P cellular response to DNA damage stimulus
GO:0006975 P DNA damage induced protein phosphorylation
GO:0007049 P cell cycle
GO:0010569 P regulation of double-strand break repair via homologous recombination
GO:0010767 P regulation of transcription from RNA polymerase II promoter in response to UV-induced DNA damage
GO:0010972 P negative regulation of G2/M transition of mitotic cell cycle
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018107 P peptidyl-threonine phosphorylation
GO:0035402 F histone kinase activity (H3-T11 specific)
GO:0035407 P histone H3-T11 phosphorylation
GO:0045839 P negative regulation of mitotic nuclear division
GO:0046602 P regulation of mitotic centrosome separation
GO:0048096 P epigenetic maintenance of chromatin in transcription-competent conformation
GO:0071310 P cellular response to organic substance
GO:0071313 P cellular response to caffeine
GO:2000279 P negative regulation of DNA biosynthetic process
GO:2000615 P regulation of histone H3-K9 acetylation
RNA-seq EntryA_TrvaFAMAMG_TR19300c0_g1_i2
Sequence
(Amino Acid)
MCAWRARRYWRETLSGLQYVHGRGVAHRDIKPENLLLDGADRVKISDFGLATVYRHAGRE
RAISRVCGTPPYAAPEVLRAEAAPYRAAPADLWSAAVVLVAMLAGELPWERAAEGDARYA
AWCGAGGG
(41 a.a.)

- SilkBase 1999-2023 -