EntryView

ORF from Assembled RNA_seq Entry

Name

O_TrvaFAMAMG23048_3prime_partial:A_TrvaFAMAMG_TR19300c0_g1_i1

Scaffold_id

NCBI non-redundant
(nr)

PREDICTED:_serine/threonine-protein_kinase_grp_isoform_X2_[Bombyx_mori]

Ontology

GO:0000077	P	DNA damage checkpoint signaling
GO:0000166	F	nucleotide binding
GO:0000785	C	chromatin
GO:0000794	C	condensed nuclear chromosome
GO:0004672	F	protein kinase activity
GO:0004674	F	protein serine/threonine kinase activity
GO:0005515	F	protein binding
GO:0005524	F	ATP binding
GO:0005575	C	cellular_component
GO:0005634	C	nucleus
GO:0005737	C	cytoplasm
GO:0005813	C	centrosome
GO:0005815	C	microtubule organizing center
GO:0005856	C	cytoskeleton
GO:0006281	P	DNA repair
GO:0006468	P	protein phosphorylation
GO:0006974	P	cellular response to DNA damage stimulus
GO:0006975	P	DNA damage induced protein phosphorylation
GO:0007049	P	cell cycle
GO:0010569	P	regulation of double-strand break repair via homologous recombination
GO:0010767	P	regulation of transcription from RNA polymerase II promoter in response to UV-induced DNA damage
GO:0010972	P	negative regulation of G2/M transition of mitotic cell cycle
GO:0016301	F	kinase activity
GO:0016310	P	phosphorylation
GO:0016740	F	transferase activity
GO:0018107	P	peptidyl-threonine phosphorylation
GO:0035402	F	histone kinase activity (H3-T11 specific)
GO:0035407	P	histone H3-T11 phosphorylation
GO:0045839	P	negative regulation of mitotic nuclear division
GO:0046602	P	regulation of mitotic centrosome separation
GO:0048096	P	epigenetic maintenance of chromatin in transcription-competent conformation
GO:0071310	P	cellular response to organic substance
GO:0071313	P	cellular response to caffeine
GO:2000279	P	negative regulation of DNA biosynthetic process
GO:2000615	P	regulation of histone H3-K9 acetylation

RNA-seq Entry

Sequence
(Amino Acid)

MCAWRARRYWRETLSGLQYVHGRGVAHRDIKPENLLLDGADRVKISDFGLATVYRHAGRE
RAISRVCGTPPYAAPEVLRAEAAPYRAAPADLWSAAVVLVAMLAGELPWERAAEGDARYA
AWCGAGGG
(41 a.a.)

- SilkBase 1999-2023 -