SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG22991_5prime_partial:A_TrvaFAMAMG_TR19260c1_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_neuroendocrine_convertase_1-like,_partial_[Amyelois_transitella]
Ontology
GO:0004175 F endopeptidase activity
GO:0004252 F serine-type endopeptidase activity
GO:0005615 C extracellular space
GO:0005791 C rough endoplasmic reticulum
GO:0005802 C trans-Golgi network
GO:0006508 P proteolysis
GO:0008233 F peptidase activity
GO:0008236 F serine-type peptidase activity
GO:0009749 P response to glucose
GO:0010035 P response to inorganic substance
GO:0010157 P response to chlorate
GO:0014070 P response to organic cyclic compound
GO:0016486 P peptide hormone processing
GO:0016540 P protein autoprocessing
GO:0016787 F hydrolase activity
GO:0021983 P pituitary gland development
GO:0022008 P neurogenesis
GO:0030133 C transport vesicle
GO:0030141 C secretory granule
GO:0030425 C dendrite
GO:0031016 P pancreas development
GO:0031410 C cytoplasmic vesicle
GO:0031667 P response to nutrient levels
GO:0032403 F protein-containing complex binding
GO:0032496 P response to lipopolysaccharide
GO:0042493 P response to xenobiotic stimulus
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0043204 C perikaryon
GO:0043278 P response to morphine
GO:0043434 P response to peptide hormone
GO:0043559 F insulin binding
GO:0043679 C axon terminus
GO:0048471 C perinuclear region of cytoplasm
GO:0048678 P response to axon injury
GO:0050714 P positive regulation of protein secretion
GO:0051087 F chaperone binding
GO:0051384 P response to glucocorticoid
GO:0051592 P response to calcium ion
GO:0070542 P response to fatty acid
GO:0070555 P response to interleukin-1
RNA-seq EntryA_TrvaFAMAMG_TR19260c1_g1_i1
Sequence
(Amino Acid)
KIVTTDIKDSCTMSHTGTSAAAPLAAGIIALALEANPSLTWRDVQHLIVWTSEYAPLSAN
PGWQINGIGLRFDIRFGFGLINAEALVTTALNWTNVPEKTTCRVTAFPIDDEEAILRTGK
DITIQINVKNCAINFLEHVEVISNIKYTRRGAVQILLVSPQGTEIQLLSPRPLDLSDEGF
YNWPLTSVGTWGENPAGIWKIIIEDKTDEHNTGKVGNFVLKLHGTNLMPAHMKNGSRKYN
NEYDYQEILDYFDSTDNDLNTVPDDVTEHLKGSRDTKEVEVNAFDSEILVAVEKELQRMH
HRKNYLPSEI
*(102 a.a.)

- SilkBase 1999-2023 -