SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG22970_complete:A_TrvaFAMAMG_TR19242c0_g2_i1
Scaffold_id
NCBI non-redundant
(nr)
protein_kinase_C1_[Plutella_xylostella]
Ontology
GO:0000166 F nucleotide binding
GO:0000188 P obsolete inactivation of MAPK activity
GO:0001525 P angiogenesis
GO:0001750 C photoreceptor outer segment
GO:0001933 P negative regulation of protein phosphorylation
GO:0001934 P positive regulation of protein phosphorylation
GO:0001938 P positive regulation of endothelial cell proliferation
GO:0002026 P regulation of the force of heart contraction
GO:0002062 P chondrocyte differentiation
GO:0002159 P desmosome assembly
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004697 F protein kinase C activity
GO:0004698 F calcium-dependent protein kinase C activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005783 C endoplasmic reticulum
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006468 P protein phosphorylation
GO:0006469 P negative regulation of protein kinase activity
GO:0006874 P cellular calcium ion homeostasis
GO:0006915 P apoptotic process
GO:0006937 P regulation of muscle contraction
GO:0007155 P cell adhesion
GO:0008270 F zinc ion binding
GO:0008285 P negative regulation of cell population proliferation
GO:0010595 P positive regulation of endothelial cell migration
GO:0010613 P positive regulation of cardiac muscle hypertrophy
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0019899 F enzyme binding
GO:0030335 P positive regulation of cell migration
GO:0030424 C axon
GO:0030425 C dendrite
GO:0030593 P neutrophil chemotaxis
GO:0031666 P positive regulation of lipopolysaccharide-mediated signaling pathway
GO:0031966 C mitochondrial membrane
GO:0034351 P negative regulation of glial cell apoptotic process
GO:0035403 F histone kinase activity (H3-T6 specific)
GO:0035408 P histone H3-T6 phosphorylation
GO:0035556 P intracellular signal transduction
GO:0036289 P peptidyl-serine autophosphorylation
GO:0043025 C neuronal cell body
GO:0043536 P positive regulation of blood vessel endothelial cell migration
GO:0045177 C apical part of cell
GO:0045651 P positive regulation of macrophage differentiation
GO:0045766 P positive regulation of angiogenesis
GO:0045785 P positive regulation of cell adhesion
GO:0045931 P positive regulation of mitotic cell cycle
GO:0046325 P negative regulation of glucose import
GO:0046627 P negative regulation of insulin receptor signaling pathway
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0050729 P positive regulation of inflammatory response
GO:0050730 P regulation of peptidyl-tyrosine phosphorylation
GO:0050930 P induction of positive chemotaxis
GO:0070062 C extracellular exosome
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:0070555 P response to interleukin-1
GO:0071322 P cellular response to carbohydrate stimulus
GO:0090330 P regulation of platelet aggregation
GO:0097193 P intrinsic apoptotic signaling pathway
GO:2000707 P positive regulation of dense core granule biogenesis
RNA-seq EntryA_TrvaFAMAMG_TR19242c0_g2_i1
Sequence
(Amino Acid)
MADEENNCDDGGGDLKVGQAFRLRGRKGALKKKNVYLIKDHKFMPRFFKQPTFCSHCKDF
IWGFGKQGFQCQVCSFVVHKRCHEYVTFTCPGADKGADSDDTRTRHNFRVHTYSSPTFCD
HCGSLLYGLIHQGLKCQGTSGPATERKP
*(48 a.a.)

- SilkBase 1999-2023 -